Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3CR86

Protein Details
Accession A0A2H3CR86    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
130-149QAEMMAKKDKRKGKKDCVIMHydrophilic
NLS Segment(s)
PositionSequence
136-143KKDKRKGK
Subcellular Location(s) mito 13, nucl 5, cyto 5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007518  MINDY  
Gene Ontology GO:0004843  F:cysteine-type deubiquitinase activity  
GO:1990380  F:K48-linked deubiquitinase activity  
Amino Acid Sequences MTYHGLFTLATTVQPVTLVTLYRNLHLSVLYKHEQALYSLVTDYVFLKEPSVVWERLEDVNGGSSMFVDSDFVRASPAGGDFAGQTAEEVVTAGSYGPSDLALTQQLQAEEHNRARYEWELYERDLGMHQAEMMAKKDKRKGKKDCVIM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.1
5 0.11
6 0.1
7 0.17
8 0.18
9 0.19
10 0.21
11 0.19
12 0.18
13 0.18
14 0.2
15 0.16
16 0.21
17 0.22
18 0.21
19 0.21
20 0.22
21 0.22
22 0.2
23 0.19
24 0.13
25 0.12
26 0.12
27 0.11
28 0.09
29 0.09
30 0.09
31 0.09
32 0.1
33 0.09
34 0.09
35 0.09
36 0.1
37 0.13
38 0.17
39 0.15
40 0.14
41 0.15
42 0.17
43 0.17
44 0.17
45 0.13
46 0.09
47 0.1
48 0.1
49 0.09
50 0.06
51 0.05
52 0.05
53 0.05
54 0.04
55 0.04
56 0.04
57 0.05
58 0.06
59 0.05
60 0.06
61 0.06
62 0.06
63 0.05
64 0.06
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.04
72 0.04
73 0.04
74 0.04
75 0.03
76 0.04
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.04
87 0.04
88 0.05
89 0.06
90 0.07
91 0.08
92 0.1
93 0.1
94 0.1
95 0.12
96 0.14
97 0.18
98 0.21
99 0.24
100 0.23
101 0.23
102 0.26
103 0.26
104 0.28
105 0.25
106 0.27
107 0.26
108 0.27
109 0.3
110 0.27
111 0.25
112 0.22
113 0.2
114 0.15
115 0.13
116 0.11
117 0.1
118 0.12
119 0.13
120 0.16
121 0.23
122 0.25
123 0.32
124 0.41
125 0.48
126 0.57
127 0.65
128 0.73
129 0.75