Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6K397

Protein Details
Accession B6K397   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAKSLRSKSVRRNKRLLRTNVFQHydrophilic
89-114RDIWAKKHLKKGGRQKKSKFAKFLKKBasic
NLS Segment(s)
PositionSequence
93-114AKKHLKKGGRQKKSKFAKFLKK
Subcellular Location(s) nucl 20, mito_nucl 13.833, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRSKSVRRNKRLLRTNVFQPVIDDRTNRLADRLRDQVNDLTDKKDNNVAEAAQKEVVDASADQMMTDEAKSKASVSTSGPRNSNRDIWAKKHLKKGGRQKKSKFAKFLKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.88
3 0.86
4 0.84
5 0.79
6 0.79
7 0.77
8 0.69
9 0.58
10 0.5
11 0.46
12 0.41
13 0.37
14 0.3
15 0.24
16 0.29
17 0.31
18 0.28
19 0.26
20 0.28
21 0.29
22 0.33
23 0.37
24 0.33
25 0.32
26 0.34
27 0.34
28 0.31
29 0.32
30 0.28
31 0.25
32 0.25
33 0.24
34 0.23
35 0.25
36 0.22
37 0.18
38 0.18
39 0.15
40 0.16
41 0.16
42 0.16
43 0.12
44 0.12
45 0.1
46 0.09
47 0.08
48 0.06
49 0.05
50 0.05
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.08
59 0.07
60 0.08
61 0.09
62 0.09
63 0.1
64 0.11
65 0.13
66 0.14
67 0.22
68 0.27
69 0.31
70 0.35
71 0.37
72 0.41
73 0.43
74 0.43
75 0.4
76 0.43
77 0.44
78 0.45
79 0.52
80 0.57
81 0.6
82 0.65
83 0.68
84 0.66
85 0.71
86 0.78
87 0.78
88 0.79
89 0.83
90 0.82
91 0.85
92 0.89
93 0.88
94 0.87