Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3EAB3

Protein Details
Accession A0A2H3EAB3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
99-121IIFVIFRYKRRKQRYLPGLHTYWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9.5, cyto_nucl 7, mito 5, plas 4, cyto 3.5, extr 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTEARDNDRDVSSTSTITTLEVQSVTTTVPQTVDVSGSIIRIESDTILSYPSQSQLSPLSTSSVLASANTDDSFQGKVKDVAIAGGVACVVVALAISVIIFVIFRYKRRKQRYLPGLHTYW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.17
4 0.17
5 0.17
6 0.12
7 0.12
8 0.11
9 0.11
10 0.1
11 0.1
12 0.1
13 0.09
14 0.09
15 0.08
16 0.09
17 0.09
18 0.1
19 0.1
20 0.1
21 0.08
22 0.09
23 0.09
24 0.09
25 0.08
26 0.07
27 0.06
28 0.06
29 0.06
30 0.05
31 0.06
32 0.06
33 0.06
34 0.07
35 0.07
36 0.07
37 0.07
38 0.09
39 0.09
40 0.08
41 0.09
42 0.1
43 0.12
44 0.12
45 0.12
46 0.12
47 0.11
48 0.12
49 0.1
50 0.09
51 0.07
52 0.07
53 0.07
54 0.05
55 0.07
56 0.06
57 0.07
58 0.06
59 0.07
60 0.09
61 0.09
62 0.1
63 0.1
64 0.11
65 0.11
66 0.13
67 0.11
68 0.1
69 0.1
70 0.08
71 0.07
72 0.06
73 0.05
74 0.04
75 0.03
76 0.03
77 0.02
78 0.02
79 0.02
80 0.02
81 0.02
82 0.02
83 0.02
84 0.02
85 0.02
86 0.02
87 0.02
88 0.03
89 0.1
90 0.12
91 0.19
92 0.28
93 0.38
94 0.48
95 0.58
96 0.69
97 0.7
98 0.8
99 0.85
100 0.87
101 0.85