Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3DI46

Protein Details
Accession A0A2H3DI46   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
151-171GDKANKIARRYRLKKPDPLQQHydrophilic
NLS Segment(s)
PositionSequence
142-165KRMKGKVLNGDKANKIARRYRLKK
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
Pfam View protein in Pfam  
PF08284  RVP_2  
CDD cd00303  retropepsin_like  
Amino Acid Sequences MGDTVPQQGRVQLRVQKEPTNRPIPRDKRCLVTALDVNGLEAVTLWDSGSTSTAMSPTFADISKAVIARLRNPVVLQLGTVGSRAKINFGTYSRIDSKGFTGPKYFDVVNIDKYNIIVGTPFMHKNKVVLDFKKKCMIVNGKRMKGKVLNGDKANKIARRYRLKKPDPLQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.49
3 0.52
4 0.56
5 0.63
6 0.65
7 0.69
8 0.66
9 0.63
10 0.7
11 0.71
12 0.73
13 0.72
14 0.66
15 0.62
16 0.61
17 0.59
18 0.5
19 0.46
20 0.41
21 0.33
22 0.33
23 0.26
24 0.24
25 0.21
26 0.18
27 0.12
28 0.08
29 0.07
30 0.05
31 0.05
32 0.05
33 0.04
34 0.05
35 0.05
36 0.06
37 0.06
38 0.06
39 0.06
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.08
46 0.08
47 0.09
48 0.08
49 0.1
50 0.11
51 0.11
52 0.1
53 0.12
54 0.12
55 0.15
56 0.2
57 0.19
58 0.18
59 0.18
60 0.19
61 0.18
62 0.18
63 0.14
64 0.09
65 0.09
66 0.08
67 0.09
68 0.07
69 0.06
70 0.07
71 0.07
72 0.08
73 0.08
74 0.09
75 0.11
76 0.12
77 0.16
78 0.15
79 0.19
80 0.2
81 0.22
82 0.21
83 0.19
84 0.2
85 0.23
86 0.24
87 0.2
88 0.2
89 0.2
90 0.2
91 0.22
92 0.2
93 0.15
94 0.19
95 0.2
96 0.23
97 0.23
98 0.22
99 0.19
100 0.19
101 0.18
102 0.13
103 0.11
104 0.06
105 0.05
106 0.07
107 0.1
108 0.14
109 0.15
110 0.18
111 0.18
112 0.19
113 0.23
114 0.29
115 0.33
116 0.36
117 0.45
118 0.49
119 0.53
120 0.59
121 0.55
122 0.48
123 0.5
124 0.54
125 0.52
126 0.57
127 0.63
128 0.63
129 0.67
130 0.66
131 0.63
132 0.58
133 0.55
134 0.55
135 0.54
136 0.55
137 0.57
138 0.62
139 0.59
140 0.59
141 0.6
142 0.54
143 0.51
144 0.51
145 0.55
146 0.6
147 0.64
148 0.69
149 0.74
150 0.77
151 0.82