Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3DF66

Protein Details
Accession A0A2H3DF66   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
11-31EDITTTPPPRKKPHCRICGMPHydrophilic
70-97VKPVVRRTPNARRRKSRAKSTPKPDIDFHydrophilic
NLS Segment(s)
PositionSequence
75-91RRTPNARRRKSRAKSTP
Subcellular Location(s) mito 11, nucl 10, cyto_nucl 9, cyto 6
Family & Domain DBs
Amino Acid Sequences MAAASVNVKVEDITTTPPPRKKPHCRICGMPMQGHRREPVYGTTVCPSEDMAYASSVASASLPTVKEEDVKPVVRRTPNARRRKSRAKSTPKPDIDFLPRKEYQRMPRTIAPDNELMHAPPRMASTWCQLGFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.26
3 0.33
4 0.39
5 0.45
6 0.53
7 0.63
8 0.7
9 0.74
10 0.78
11 0.81
12 0.81
13 0.8
14 0.77
15 0.76
16 0.68
17 0.62
18 0.59
19 0.58
20 0.56
21 0.52
22 0.47
23 0.4
24 0.36
25 0.33
26 0.28
27 0.25
28 0.21
29 0.21
30 0.21
31 0.2
32 0.19
33 0.18
34 0.15
35 0.12
36 0.11
37 0.11
38 0.09
39 0.09
40 0.09
41 0.09
42 0.08
43 0.07
44 0.06
45 0.05
46 0.04
47 0.04
48 0.05
49 0.06
50 0.06
51 0.07
52 0.07
53 0.1
54 0.1
55 0.14
56 0.15
57 0.18
58 0.19
59 0.21
60 0.26
61 0.26
62 0.29
63 0.33
64 0.41
65 0.48
66 0.57
67 0.64
68 0.68
69 0.75
70 0.83
71 0.83
72 0.83
73 0.84
74 0.84
75 0.85
76 0.85
77 0.86
78 0.81
79 0.76
80 0.66
81 0.61
82 0.59
83 0.58
84 0.53
85 0.5
86 0.48
87 0.47
88 0.51
89 0.53
90 0.54
91 0.55
92 0.57
93 0.55
94 0.57
95 0.6
96 0.61
97 0.56
98 0.5
99 0.45
100 0.41
101 0.37
102 0.33
103 0.28
104 0.25
105 0.22
106 0.19
107 0.15
108 0.16
109 0.16
110 0.18
111 0.2
112 0.22
113 0.3