Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JVE5

Protein Details
Accession B6JVE5    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
15-34SWYPKFKKLTPRARILKPIPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 1, pero 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR009772  CDC123  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005524  F:ATP binding  
GO:0000287  F:magnesium ion binding  
GO:1905143  P:eukaryotic translation initiation factor 2 complex assembly  
GO:0045948  P:positive regulation of translational initiation  
Pfam View protein in Pfam  
PF07065  D123  
Amino Acid Sequences METTKAHVLNCQFSSWYPKFKKLTPRARILKPIPPSVLNYLNQDGIFLGGSDDDENEDDGEIKDEDDENVQRARVSAEDLKLITDTIEELGGSVVPKLNWSTPKDALWIAPTNSLKCTNASDILLLLKASDFVAHDLDDPFDNCKDDVVGKLTENFSYELVLKEWFPIHTSHEYRCFVKGRKLVAVSQRDPNYYDFLEKEAPEHLELLIELSEKLHDFPDENFVFDAYIQKDRAFLIDINPYSLTTDGQLFSWSEINKLNTDDPVLRLVPKGPFGSSGSMYSENRVPFDMVAANLGGNISEFANSMQQSMAAEEKKDKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.37
3 0.43
4 0.4
5 0.48
6 0.51
7 0.56
8 0.66
9 0.67
10 0.74
11 0.72
12 0.78
13 0.78
14 0.8
15 0.83
16 0.77
17 0.74
18 0.7
19 0.67
20 0.6
21 0.54
22 0.51
23 0.47
24 0.48
25 0.42
26 0.4
27 0.36
28 0.35
29 0.32
30 0.28
31 0.22
32 0.17
33 0.15
34 0.1
35 0.08
36 0.05
37 0.06
38 0.07
39 0.07
40 0.07
41 0.08
42 0.08
43 0.08
44 0.08
45 0.08
46 0.08
47 0.1
48 0.09
49 0.09
50 0.09
51 0.1
52 0.1
53 0.13
54 0.14
55 0.14
56 0.15
57 0.15
58 0.14
59 0.14
60 0.15
61 0.12
62 0.16
63 0.18
64 0.18
65 0.2
66 0.2
67 0.2
68 0.19
69 0.18
70 0.13
71 0.09
72 0.08
73 0.06
74 0.06
75 0.05
76 0.05
77 0.05
78 0.06
79 0.05
80 0.05
81 0.06
82 0.06
83 0.07
84 0.09
85 0.13
86 0.18
87 0.21
88 0.26
89 0.27
90 0.28
91 0.29
92 0.28
93 0.25
94 0.24
95 0.23
96 0.19
97 0.23
98 0.23
99 0.22
100 0.24
101 0.25
102 0.22
103 0.2
104 0.21
105 0.17
106 0.18
107 0.17
108 0.15
109 0.13
110 0.13
111 0.12
112 0.09
113 0.07
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.06
120 0.06
121 0.07
122 0.08
123 0.08
124 0.08
125 0.08
126 0.08
127 0.09
128 0.09
129 0.1
130 0.09
131 0.08
132 0.08
133 0.08
134 0.09
135 0.1
136 0.1
137 0.1
138 0.12
139 0.13
140 0.12
141 0.13
142 0.13
143 0.1
144 0.1
145 0.1
146 0.08
147 0.09
148 0.09
149 0.08
150 0.08
151 0.08
152 0.08
153 0.08
154 0.09
155 0.12
156 0.18
157 0.2
158 0.21
159 0.27
160 0.29
161 0.29
162 0.32
163 0.33
164 0.29
165 0.34
166 0.36
167 0.32
168 0.35
169 0.35
170 0.36
171 0.39
172 0.44
173 0.39
174 0.41
175 0.4
176 0.37
177 0.37
178 0.34
179 0.3
180 0.23
181 0.22
182 0.16
183 0.17
184 0.18
185 0.16
186 0.16
187 0.15
188 0.15
189 0.14
190 0.14
191 0.11
192 0.09
193 0.09
194 0.09
195 0.07
196 0.06
197 0.06
198 0.05
199 0.06
200 0.06
201 0.07
202 0.07
203 0.07
204 0.08
205 0.09
206 0.17
207 0.17
208 0.18
209 0.17
210 0.16
211 0.16
212 0.15
213 0.19
214 0.12
215 0.16
216 0.16
217 0.16
218 0.17
219 0.17
220 0.18
221 0.16
222 0.14
223 0.14
224 0.2
225 0.2
226 0.21
227 0.21
228 0.2
229 0.19
230 0.19
231 0.16
232 0.1
233 0.12
234 0.1
235 0.1
236 0.11
237 0.11
238 0.12
239 0.15
240 0.14
241 0.14
242 0.18
243 0.2
244 0.2
245 0.22
246 0.22
247 0.19
248 0.22
249 0.22
250 0.19
251 0.21
252 0.2
253 0.19
254 0.18
255 0.21
256 0.21
257 0.23
258 0.23
259 0.2
260 0.22
261 0.24
262 0.27
263 0.25
264 0.24
265 0.24
266 0.27
267 0.27
268 0.27
269 0.29
270 0.26
271 0.26
272 0.26
273 0.23
274 0.18
275 0.2
276 0.19
277 0.14
278 0.15
279 0.14
280 0.12
281 0.11
282 0.11
283 0.08
284 0.06
285 0.07
286 0.06
287 0.06
288 0.07
289 0.08
290 0.13
291 0.13
292 0.14
293 0.13
294 0.13
295 0.13
296 0.15
297 0.21
298 0.18
299 0.2