Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3DWN3

Protein Details
Accession A0A2H3DWN3   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
98-126TYDRPVRQSYPPRKCRICRRSQKGEAIYAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MTPSPGYTGTRRPRSPSPLRNRLAGAPPADDLSPPKRTREDYDYYSGRASYERPVSPAQPPPTSAGSSYYDSSRAPPTPASTVGSGAPPEYSRDCPATYDRPVRQSYPPRKCRICRRSQKGEAIYASFSIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.73
3 0.74
4 0.74
5 0.75
6 0.74
7 0.71
8 0.66
9 0.61
10 0.56
11 0.5
12 0.41
13 0.32
14 0.3
15 0.28
16 0.25
17 0.21
18 0.19
19 0.19
20 0.26
21 0.25
22 0.28
23 0.31
24 0.34
25 0.4
26 0.43
27 0.44
28 0.41
29 0.47
30 0.45
31 0.42
32 0.39
33 0.33
34 0.27
35 0.21
36 0.17
37 0.15
38 0.19
39 0.18
40 0.2
41 0.21
42 0.23
43 0.26
44 0.31
45 0.3
46 0.26
47 0.27
48 0.27
49 0.28
50 0.26
51 0.23
52 0.19
53 0.18
54 0.19
55 0.18
56 0.16
57 0.15
58 0.14
59 0.16
60 0.16
61 0.14
62 0.14
63 0.14
64 0.16
65 0.17
66 0.19
67 0.19
68 0.16
69 0.16
70 0.15
71 0.15
72 0.13
73 0.11
74 0.1
75 0.09
76 0.11
77 0.13
78 0.15
79 0.17
80 0.19
81 0.19
82 0.21
83 0.26
84 0.29
85 0.33
86 0.38
87 0.39
88 0.43
89 0.46
90 0.47
91 0.51
92 0.56
93 0.6
94 0.63
95 0.68
96 0.71
97 0.77
98 0.83
99 0.85
100 0.85
101 0.85
102 0.85
103 0.86
104 0.88
105 0.88
106 0.89
107 0.83
108 0.79
109 0.71
110 0.63
111 0.55