Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3CWP7

Protein Details
Accession A0A2H3CWP7   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-28RYKRLGEAYRPPRKRVKNRKAISTRLTHydrophilic
NLS Segment(s)
PositionSequence
11-22RPPRKRVKNRKA
Subcellular Location(s) mito_nucl 11.833, mito 11.5, nucl 11, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR028261  DPD_II  
IPR009051  Helical_ferredxn  
Gene Ontology GO:0051536  F:iron-sulfur cluster binding  
Pfam View protein in Pfam  
PF14691  Fer4_20  
Amino Acid Sequences MRYKRLGEAYRPPRKRVKNRKAISTRLTESKLKYQSARCMDCGVTFCQSDTGCPISNIIPKWNDLVFKGQWRDALNRILMTNNFPEFTGRVCPAPCEGACVLEISEQPCRYQKYC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.8
3 0.81
4 0.81
5 0.81
6 0.83
7 0.89
8 0.86
9 0.84
10 0.78
11 0.74
12 0.67
13 0.62
14 0.6
15 0.53
16 0.49
17 0.49
18 0.48
19 0.43
20 0.44
21 0.43
22 0.47
23 0.51
24 0.5
25 0.42
26 0.4
27 0.37
28 0.34
29 0.32
30 0.25
31 0.19
32 0.16
33 0.15
34 0.15
35 0.15
36 0.13
37 0.13
38 0.14
39 0.12
40 0.12
41 0.13
42 0.12
43 0.15
44 0.16
45 0.16
46 0.14
47 0.14
48 0.16
49 0.17
50 0.15
51 0.13
52 0.17
53 0.16
54 0.21
55 0.22
56 0.21
57 0.23
58 0.25
59 0.27
60 0.26
61 0.28
62 0.23
63 0.22
64 0.22
65 0.21
66 0.2
67 0.19
68 0.19
69 0.17
70 0.16
71 0.15
72 0.16
73 0.15
74 0.16
75 0.18
76 0.16
77 0.17
78 0.17
79 0.19
80 0.19
81 0.24
82 0.22
83 0.22
84 0.21
85 0.2
86 0.2
87 0.19
88 0.17
89 0.15
90 0.17
91 0.15
92 0.21
93 0.21
94 0.24
95 0.29