Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K7G5

Protein Details
Accession B6K7G5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
308-329LFYLSWRERRNRKRAADNEEVVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 22, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004923  FTR1/Fip1/EfeU  
Gene Ontology GO:0033573  C:high-affinity iron permease complex  
GO:0005886  C:plasma membrane  
GO:0015093  F:ferrous iron transmembrane transporter activity  
GO:0061840  F:high-affinity ferrous iron transmembrane transporter activity  
GO:0034755  P:iron ion transmembrane transport  
GO:0033215  P:reductive iron assimilation  
Pfam View protein in Pfam  
PF03239  FTR1  
Amino Acid Sequences MAKNVFSVAVFFIVLRETLEAAIIVSVLLSFIKQTLADENGKITDRKLFRKLFLHVWLGSAVAFLICLAIGGGFIGAFYALQKDLWGSSEEIWEGVFSLIAVILISIMGVAMLRVSHLQEKWRKKLMNSLANEKAKGIKGWTKKYSMFLLPFVTVLREGLEVVVFVGGVGLSTPATAFPLAVFCGLLVGAAIGYFIYKGGNVMNLQWFLIASTCILYLIAAGLMSKAVYYFEMYQWNKLTGGDASEQGSGPGSYDFRHAIWHVNYGNPELNDNGGWMIFNAIFGWNNTGTYGNILSYIFYWVILAIVLFYLSWRERRNRKRAADNEEVVGTTGTSSDSSPGVFVSEKKKEDISDEGSMTIVRIEQQAITHGSGEEIVDKQTDKVGETFTVVKRQTSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.09
5 0.09
6 0.09
7 0.08
8 0.08
9 0.08
10 0.07
11 0.05
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.04
18 0.05
19 0.06
20 0.06
21 0.08
22 0.12
23 0.17
24 0.2
25 0.2
26 0.21
27 0.23
28 0.26
29 0.25
30 0.22
31 0.26
32 0.3
33 0.36
34 0.43
35 0.45
36 0.48
37 0.54
38 0.57
39 0.55
40 0.55
41 0.53
42 0.44
43 0.41
44 0.36
45 0.29
46 0.25
47 0.18
48 0.12
49 0.06
50 0.05
51 0.04
52 0.04
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.05
67 0.05
68 0.06
69 0.06
70 0.07
71 0.07
72 0.09
73 0.11
74 0.1
75 0.11
76 0.13
77 0.13
78 0.13
79 0.12
80 0.1
81 0.09
82 0.08
83 0.06
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.03
90 0.03
91 0.03
92 0.03
93 0.02
94 0.02
95 0.02
96 0.02
97 0.02
98 0.02
99 0.02
100 0.03
101 0.04
102 0.06
103 0.1
104 0.11
105 0.2
106 0.29
107 0.37
108 0.44
109 0.52
110 0.53
111 0.5
112 0.58
113 0.6
114 0.6
115 0.55
116 0.55
117 0.56
118 0.55
119 0.55
120 0.45
121 0.4
122 0.32
123 0.29
124 0.26
125 0.24
126 0.3
127 0.38
128 0.41
129 0.42
130 0.43
131 0.45
132 0.45
133 0.42
134 0.37
135 0.3
136 0.28
137 0.24
138 0.22
139 0.19
140 0.16
141 0.11
142 0.09
143 0.08
144 0.06
145 0.06
146 0.06
147 0.05
148 0.05
149 0.05
150 0.04
151 0.03
152 0.03
153 0.03
154 0.02
155 0.02
156 0.02
157 0.02
158 0.02
159 0.02
160 0.03
161 0.03
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.05
168 0.05
169 0.05
170 0.04
171 0.04
172 0.04
173 0.04
174 0.03
175 0.02
176 0.02
177 0.02
178 0.02
179 0.02
180 0.02
181 0.02
182 0.02
183 0.02
184 0.02
185 0.03
186 0.03
187 0.05
188 0.05
189 0.06
190 0.08
191 0.08
192 0.08
193 0.08
194 0.08
195 0.06
196 0.06
197 0.05
198 0.04
199 0.04
200 0.04
201 0.04
202 0.04
203 0.04
204 0.03
205 0.03
206 0.03
207 0.03
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.04
216 0.05
217 0.07
218 0.08
219 0.17
220 0.18
221 0.21
222 0.22
223 0.22
224 0.21
225 0.2
226 0.19
227 0.11
228 0.13
229 0.11
230 0.11
231 0.11
232 0.12
233 0.12
234 0.1
235 0.11
236 0.08
237 0.08
238 0.08
239 0.07
240 0.07
241 0.09
242 0.1
243 0.1
244 0.12
245 0.12
246 0.17
247 0.18
248 0.22
249 0.21
250 0.22
251 0.23
252 0.23
253 0.25
254 0.2
255 0.2
256 0.15
257 0.15
258 0.13
259 0.12
260 0.1
261 0.07
262 0.07
263 0.06
264 0.07
265 0.06
266 0.06
267 0.06
268 0.06
269 0.07
270 0.07
271 0.11
272 0.1
273 0.1
274 0.1
275 0.11
276 0.1
277 0.11
278 0.12
279 0.08
280 0.09
281 0.09
282 0.09
283 0.08
284 0.1
285 0.08
286 0.08
287 0.08
288 0.07
289 0.07
290 0.06
291 0.05
292 0.03
293 0.03
294 0.03
295 0.03
296 0.03
297 0.07
298 0.09
299 0.14
300 0.19
301 0.28
302 0.39
303 0.49
304 0.6
305 0.66
306 0.73
307 0.79
308 0.83
309 0.83
310 0.82
311 0.73
312 0.66
313 0.56
314 0.48
315 0.38
316 0.29
317 0.2
318 0.11
319 0.09
320 0.07
321 0.07
322 0.07
323 0.08
324 0.08
325 0.08
326 0.09
327 0.08
328 0.1
329 0.1
330 0.14
331 0.21
332 0.28
333 0.3
334 0.32
335 0.35
336 0.34
337 0.36
338 0.39
339 0.37
340 0.34
341 0.33
342 0.31
343 0.29
344 0.28
345 0.24
346 0.18
347 0.12
348 0.08
349 0.09
350 0.1
351 0.11
352 0.11
353 0.15
354 0.18
355 0.18
356 0.18
357 0.17
358 0.16
359 0.15
360 0.15
361 0.14
362 0.12
363 0.12
364 0.12
365 0.13
366 0.14
367 0.17
368 0.18
369 0.17
370 0.18
371 0.2
372 0.19
373 0.22
374 0.27
375 0.27
376 0.35
377 0.34