Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3DE48

Protein Details
Accession A0A2H3DE48    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MFKLPGRHRHIKKYRVHFKGBasic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
Amino Acid Sequences MFKLPGRHRHIKKYRVHFKGLPSNEDEWKTLAELKNAPLVLHKWRNGKGTLSDEKEVMEAEQCVSIC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.79
3 0.79
4 0.72
5 0.7
6 0.71
7 0.64
8 0.56
9 0.49
10 0.47
11 0.43
12 0.41
13 0.34
14 0.24
15 0.22
16 0.19
17 0.19
18 0.17
19 0.16
20 0.15
21 0.15
22 0.18
23 0.18
24 0.17
25 0.14
26 0.15
27 0.21
28 0.26
29 0.29
30 0.32
31 0.36
32 0.39
33 0.4
34 0.41
35 0.38
36 0.4
37 0.43
38 0.42
39 0.4
40 0.36
41 0.35
42 0.32
43 0.28
44 0.21
45 0.15
46 0.11
47 0.1