Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6K1X7

Protein Details
Accession B6K1X7    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
106-135RGYKAMLLHKQKKRKLVKRLEKWRICINNHHydrophilic
NLS Segment(s)
PositionSequence
115-125KQKKRKLVKRL
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Gene Ontology GO:0140445  C:chromosome, telomeric repeat region  
GO:0035974  C:meiotic spindle pole body  
GO:0110092  C:nucleus leading edge  
GO:0030674  F:protein-macromolecule adaptor activity  
GO:0032121  P:meiotic attachment of telomeric heterochromatin to spindle pole body  
Amino Acid Sequences MHFLASHLLTFQQNDIYYLTQVALYTESPICNHGNCRDAQILKHRFLRIALQGIEELYATLPNIWQYAVLSSSNEAGKEVLIREEPIPQTNKTIQYCILPWERQLRGYKAMLLHKQKKRKLVKRLEKWRICINNH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.17
4 0.16
5 0.16
6 0.15
7 0.11
8 0.11
9 0.1
10 0.1
11 0.09
12 0.11
13 0.12
14 0.12
15 0.12
16 0.15
17 0.15
18 0.15
19 0.19
20 0.19
21 0.22
22 0.21
23 0.25
24 0.27
25 0.27
26 0.29
27 0.36
28 0.37
29 0.38
30 0.44
31 0.4
32 0.36
33 0.36
34 0.37
35 0.3
36 0.29
37 0.25
38 0.2
39 0.19
40 0.18
41 0.18
42 0.13
43 0.1
44 0.05
45 0.05
46 0.04
47 0.04
48 0.04
49 0.04
50 0.05
51 0.04
52 0.04
53 0.04
54 0.05
55 0.06
56 0.06
57 0.06
58 0.06
59 0.08
60 0.08
61 0.08
62 0.08
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.08
70 0.09
71 0.13
72 0.14
73 0.17
74 0.19
75 0.19
76 0.23
77 0.26
78 0.32
79 0.29
80 0.3
81 0.27
82 0.26
83 0.26
84 0.27
85 0.29
86 0.23
87 0.25
88 0.31
89 0.31
90 0.34
91 0.39
92 0.38
93 0.38
94 0.38
95 0.38
96 0.36
97 0.43
98 0.46
99 0.51
100 0.57
101 0.6
102 0.69
103 0.71
104 0.76
105 0.8
106 0.81
107 0.81
108 0.83
109 0.85
110 0.87
111 0.92
112 0.93
113 0.9
114 0.85
115 0.85