Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3D5V7

Protein Details
Accession A0A2H3D5V7   
Localization Confidence Low
Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-26AGYSRVVRPHHRSLKKYKVGEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto_nucl 5.5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR025789  DOT1_dom  
IPR030445  H3-K79_meTrfase  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0140956  F:histone H3K79 trimethyltransferase activity  
GO:0034729  P:histone H3-K79 methylation  
GO:0051726  P:regulation of cell cycle  
Pfam View protein in Pfam  
PF08123  DOT1  
PROSITE View protein in PROSITE  
PS51569  DOT1  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences QHIIEAGYSRVVRPHHRSLKKYKVGESQQYREIRSVLIDNIVDVAGIGPHSTFIDLGSGVGNVCSQISLKTGCRCYGVELLANPAQLARALSEQIRVFSYIWGYKHKGQVDLHHGDMRTNGTTMPAIREADVIYINNFKFEPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.52
3 0.6
4 0.67
5 0.73
6 0.8
7 0.81
8 0.79
9 0.74
10 0.74
11 0.73
12 0.75
13 0.73
14 0.67
15 0.66
16 0.64
17 0.59
18 0.51
19 0.44
20 0.34
21 0.27
22 0.24
23 0.17
24 0.16
25 0.14
26 0.12
27 0.12
28 0.11
29 0.09
30 0.07
31 0.06
32 0.04
33 0.04
34 0.04
35 0.03
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.04
49 0.04
50 0.04
51 0.04
52 0.03
53 0.04
54 0.05
55 0.07
56 0.1
57 0.14
58 0.16
59 0.16
60 0.18
61 0.18
62 0.19
63 0.2
64 0.18
65 0.16
66 0.15
67 0.18
68 0.17
69 0.16
70 0.13
71 0.1
72 0.09
73 0.08
74 0.09
75 0.06
76 0.06
77 0.07
78 0.08
79 0.12
80 0.12
81 0.13
82 0.13
83 0.14
84 0.13
85 0.13
86 0.16
87 0.15
88 0.17
89 0.21
90 0.25
91 0.28
92 0.34
93 0.35
94 0.37
95 0.36
96 0.41
97 0.44
98 0.44
99 0.42
100 0.39
101 0.37
102 0.32
103 0.32
104 0.28
105 0.22
106 0.18
107 0.15
108 0.13
109 0.15
110 0.16
111 0.18
112 0.18
113 0.18
114 0.18
115 0.19
116 0.17
117 0.17
118 0.18
119 0.15
120 0.14
121 0.2
122 0.19
123 0.2