Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3E2I6

Protein Details
Accession A0A2H3E2I6   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
31-52FVDKTRPWRRCHEQYRVPIVRRHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, nucl 11, cyto_pero 7.5, pero 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018631  AAA-ATPase-like_dom  
Pfam View protein in Pfam  
PF09820  AAA-ATPase_like  
Amino Acid Sequences MKEANRPGTPVIPWTSLTDFNQLATTPGVLFVDKTRPWRRCHEQYRVPIVRRPRGYGKTTLLAMLAALHDVRRTDVTFLEGSDAPECLVLEFDMNHSTLITSSAQDFQSTLNKYVLDTLTNFMQKYKEYLGLTEEQIQDCCRNFPTNGSCIIAVMKFVKKSDWPIFLSIDNYNAPILEKNVHALKRRLEEILGIHFYQFVEGYIIPQAEAGLIVGGILPEGLAQTCYHLIRHFGLGRCDGSWDCTESKFAQEMFGLTKAQVRTLDTVINPNGSPRGPDILKDLKFLRIVPRQFATDGDWSTEAAMFSMEEVLKVISLRSGMPRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.32
4 0.33
5 0.33
6 0.29
7 0.27
8 0.27
9 0.23
10 0.21
11 0.17
12 0.16
13 0.11
14 0.11
15 0.11
16 0.1
17 0.11
18 0.13
19 0.2
20 0.22
21 0.31
22 0.39
23 0.45
24 0.5
25 0.59
26 0.65
27 0.68
28 0.75
29 0.76
30 0.76
31 0.8
32 0.86
33 0.85
34 0.78
35 0.73
36 0.72
37 0.71
38 0.65
39 0.62
40 0.6
41 0.59
42 0.6
43 0.62
44 0.57
45 0.52
46 0.49
47 0.43
48 0.34
49 0.27
50 0.22
51 0.15
52 0.1
53 0.07
54 0.07
55 0.06
56 0.07
57 0.07
58 0.09
59 0.1
60 0.11
61 0.12
62 0.12
63 0.15
64 0.15
65 0.14
66 0.17
67 0.15
68 0.16
69 0.15
70 0.14
71 0.11
72 0.11
73 0.11
74 0.07
75 0.07
76 0.06
77 0.06
78 0.06
79 0.07
80 0.08
81 0.08
82 0.08
83 0.08
84 0.08
85 0.07
86 0.09
87 0.08
88 0.08
89 0.09
90 0.12
91 0.12
92 0.12
93 0.12
94 0.12
95 0.18
96 0.2
97 0.21
98 0.19
99 0.19
100 0.19
101 0.22
102 0.21
103 0.15
104 0.14
105 0.13
106 0.15
107 0.17
108 0.17
109 0.14
110 0.15
111 0.14
112 0.16
113 0.17
114 0.19
115 0.17
116 0.18
117 0.19
118 0.2
119 0.21
120 0.23
121 0.22
122 0.18
123 0.18
124 0.18
125 0.17
126 0.16
127 0.16
128 0.12
129 0.13
130 0.13
131 0.18
132 0.2
133 0.2
134 0.21
135 0.21
136 0.19
137 0.17
138 0.17
139 0.12
140 0.1
141 0.1
142 0.1
143 0.1
144 0.11
145 0.12
146 0.12
147 0.18
148 0.22
149 0.24
150 0.23
151 0.24
152 0.26
153 0.25
154 0.26
155 0.2
156 0.17
157 0.13
158 0.12
159 0.1
160 0.09
161 0.09
162 0.07
163 0.08
164 0.08
165 0.08
166 0.09
167 0.14
168 0.17
169 0.21
170 0.23
171 0.27
172 0.28
173 0.3
174 0.28
175 0.24
176 0.22
177 0.2
178 0.21
179 0.19
180 0.16
181 0.14
182 0.14
183 0.14
184 0.12
185 0.11
186 0.07
187 0.06
188 0.06
189 0.07
190 0.08
191 0.08
192 0.07
193 0.07
194 0.07
195 0.05
196 0.05
197 0.04
198 0.03
199 0.03
200 0.03
201 0.03
202 0.02
203 0.02
204 0.02
205 0.02
206 0.02
207 0.02
208 0.03
209 0.04
210 0.04
211 0.06
212 0.08
213 0.09
214 0.1
215 0.11
216 0.13
217 0.14
218 0.19
219 0.22
220 0.23
221 0.25
222 0.27
223 0.27
224 0.25
225 0.26
226 0.21
227 0.2
228 0.19
229 0.19
230 0.18
231 0.17
232 0.2
233 0.19
234 0.21
235 0.21
236 0.19
237 0.18
238 0.16
239 0.17
240 0.17
241 0.18
242 0.15
243 0.13
244 0.18
245 0.16
246 0.18
247 0.19
248 0.18
249 0.2
250 0.21
251 0.24
252 0.2
253 0.26
254 0.25
255 0.25
256 0.23
257 0.21
258 0.23
259 0.19
260 0.2
261 0.17
262 0.22
263 0.21
264 0.22
265 0.27
266 0.33
267 0.34
268 0.36
269 0.36
270 0.33
271 0.34
272 0.35
273 0.38
274 0.38
275 0.4
276 0.41
277 0.42
278 0.41
279 0.4
280 0.39
281 0.35
282 0.32
283 0.3
284 0.28
285 0.25
286 0.23
287 0.23
288 0.23
289 0.18
290 0.12
291 0.12
292 0.08
293 0.08
294 0.12
295 0.11
296 0.09
297 0.1
298 0.1
299 0.1
300 0.11
301 0.1
302 0.08
303 0.09
304 0.11