Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3CAU5

Protein Details
Accession A0A2H3CAU5   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPQPSTRRNAQRRRHRQERSDDSFPCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MPQPSTRRNAQRRRHRQERSDDSFPCKDLFDAVLDKNLNPSEILHQVRRNLSLISASDIHYDPACSLSEEEFDELSVPIAVESRTRYIPGPITYYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.91
3 0.89
4 0.89
5 0.89
6 0.86
7 0.82
8 0.75
9 0.71
10 0.64
11 0.56
12 0.46
13 0.36
14 0.28
15 0.21
16 0.19
17 0.14
18 0.15
19 0.14
20 0.17
21 0.17
22 0.17
23 0.18
24 0.17
25 0.15
26 0.12
27 0.13
28 0.12
29 0.17
30 0.2
31 0.2
32 0.22
33 0.25
34 0.26
35 0.27
36 0.25
37 0.18
38 0.16
39 0.15
40 0.13
41 0.12
42 0.12
43 0.11
44 0.12
45 0.13
46 0.13
47 0.11
48 0.11
49 0.09
50 0.09
51 0.09
52 0.08
53 0.09
54 0.09
55 0.1
56 0.11
57 0.12
58 0.1
59 0.1
60 0.1
61 0.09
62 0.09
63 0.08
64 0.07
65 0.05
66 0.07
67 0.07
68 0.08
69 0.11
70 0.14
71 0.15
72 0.17
73 0.18
74 0.22
75 0.28
76 0.29