Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3DDT0

Protein Details
Accession A0A2H3DDT0    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
63-82EHARAYPGYKYKPRRSKRGKBasic
NLS Segment(s)
PositionSequence
55-82GLAKERKEEHARAYPGYKYKPRRSKRGK
Subcellular Location(s) nucl 18.5, cyto_nucl 14, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences DEPHIPRPSNAYIIFRSEFVALNKESLSKTQKMASKLAGAAWRRLPKEIQDHYKGLAKERKEEHARAYPGYKYKPRRSKRGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.3
3 0.28
4 0.23
5 0.23
6 0.19
7 0.22
8 0.17
9 0.17
10 0.17
11 0.17
12 0.16
13 0.19
14 0.22
15 0.2
16 0.21
17 0.25
18 0.29
19 0.3
20 0.32
21 0.29
22 0.26
23 0.24
24 0.25
25 0.25
26 0.21
27 0.21
28 0.24
29 0.27
30 0.25
31 0.26
32 0.25
33 0.24
34 0.33
35 0.37
36 0.39
37 0.39
38 0.4
39 0.4
40 0.44
41 0.4
42 0.38
43 0.37
44 0.32
45 0.35
46 0.37
47 0.44
48 0.45
49 0.47
50 0.47
51 0.5
52 0.51
53 0.47
54 0.47
55 0.44
56 0.45
57 0.51
58 0.53
59 0.54
60 0.63
61 0.7
62 0.76