Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3CKL9

Protein Details
Accession A0A2H3CKL9    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-25LDCILSDKKKYKKKAIQKSLVLKTWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto_nucl 10.5, nucl 7.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences LDCILSDKKKYKKKAIQKSLVLKTWQGTLLQESSLPEDWTRENGVLVGIIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.86
3 0.86
4 0.86
5 0.87
6 0.82
7 0.75
8 0.66
9 0.55
10 0.45
11 0.37
12 0.29
13 0.2
14 0.15
15 0.12
16 0.12
17 0.11
18 0.11
19 0.1
20 0.12
21 0.13
22 0.14
23 0.12
24 0.13
25 0.14
26 0.17
27 0.18
28 0.15
29 0.15
30 0.14
31 0.14