Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3CUK6

Protein Details
Accession A0A2H3CUK6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
66-85TTCLASLRRHWRCRRGTSVTHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, mito 4, E.R. 4, extr 2, golg 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MVYTQLGILTILCVSMFFQRIMLDRYIPGCRIHETFVHDRPRALSLGRCFEVLFMTSHRLVCSTSTTCLASLRRHWRCRRGTSVTTRETSPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.09
3 0.11
4 0.1
5 0.11
6 0.12
7 0.15
8 0.18
9 0.18
10 0.16
11 0.15
12 0.18
13 0.2
14 0.2
15 0.19
16 0.18
17 0.2
18 0.2
19 0.2
20 0.2
21 0.24
22 0.28
23 0.33
24 0.38
25 0.36
26 0.35
27 0.34
28 0.33
29 0.28
30 0.23
31 0.21
32 0.17
33 0.21
34 0.21
35 0.2
36 0.18
37 0.17
38 0.17
39 0.13
40 0.11
41 0.08
42 0.11
43 0.12
44 0.13
45 0.12
46 0.12
47 0.12
48 0.12
49 0.16
50 0.15
51 0.15
52 0.17
53 0.18
54 0.17
55 0.21
56 0.23
57 0.22
58 0.29
59 0.39
60 0.46
61 0.55
62 0.64
63 0.7
64 0.76
65 0.8
66 0.8
67 0.78
68 0.77
69 0.78
70 0.79
71 0.75
72 0.69