Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3D2F9

Protein Details
Accession A0A2H3D2F9   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
176-197LNPPPNKRAKTKKPPPEEGDKEBasic
NLS Segment(s)
PositionSequence
178-190PPPNKRAKTKKPP
Subcellular Location(s) nucl 15, cyto 5, extr 3, mito 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
IPR001578  Peptidase_C12_UCH  
IPR036959  Peptidase_C12_UCH_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0004843  F:cysteine-type deubiquitinase activity  
GO:0006511  P:ubiquitin-dependent protein catabolic process  
Pfam View protein in Pfam  
PF01088  Peptidase_C12  
Amino Acid Sequences MASTSNVRPRQALDLHPYSLLILMYAGVFTSLTLKLGVKHLDIVEVYDIEPWAVDHLHPYGLVFCFRWRKDTHRPTDFKDPAAEHVWFVNQLSDDACASQAILYVLFNCSDVDIGKELSEFKEYTREMSPKIKGLTISNSSTILNTHNSLAQYVPLNHLHPQPSSTLQKRRMKQDLNPPPNKRAKTKKPPPEEGDKETYHFISYVPAYGKVWELDRLKSGPLEVTSLLAIVDDAYEKASDEWEYWKSEQWQLKRRLDEGWEEVADPSLLSATKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.43
3 0.41
4 0.39
5 0.31
6 0.28
7 0.21
8 0.13
9 0.08
10 0.07
11 0.06
12 0.06
13 0.06
14 0.04
15 0.04
16 0.04
17 0.07
18 0.07
19 0.08
20 0.09
21 0.1
22 0.12
23 0.16
24 0.18
25 0.16
26 0.19
27 0.19
28 0.2
29 0.19
30 0.19
31 0.16
32 0.14
33 0.14
34 0.11
35 0.11
36 0.09
37 0.09
38 0.07
39 0.07
40 0.07
41 0.07
42 0.08
43 0.09
44 0.1
45 0.1
46 0.1
47 0.11
48 0.11
49 0.13
50 0.12
51 0.17
52 0.25
53 0.26
54 0.31
55 0.31
56 0.39
57 0.48
58 0.58
59 0.62
60 0.64
61 0.67
62 0.68
63 0.76
64 0.7
65 0.6
66 0.54
67 0.45
68 0.39
69 0.39
70 0.33
71 0.22
72 0.21
73 0.2
74 0.15
75 0.14
76 0.12
77 0.09
78 0.09
79 0.08
80 0.09
81 0.08
82 0.08
83 0.08
84 0.06
85 0.06
86 0.05
87 0.06
88 0.05
89 0.05
90 0.05
91 0.05
92 0.06
93 0.06
94 0.07
95 0.05
96 0.05
97 0.06
98 0.06
99 0.06
100 0.07
101 0.07
102 0.06
103 0.07
104 0.07
105 0.08
106 0.1
107 0.09
108 0.08
109 0.15
110 0.15
111 0.17
112 0.21
113 0.21
114 0.22
115 0.27
116 0.28
117 0.25
118 0.26
119 0.25
120 0.21
121 0.22
122 0.24
123 0.22
124 0.21
125 0.19
126 0.18
127 0.17
128 0.17
129 0.16
130 0.13
131 0.1
132 0.1
133 0.1
134 0.11
135 0.11
136 0.11
137 0.1
138 0.1
139 0.1
140 0.1
141 0.13
142 0.13
143 0.14
144 0.16
145 0.18
146 0.19
147 0.17
148 0.17
149 0.16
150 0.2
151 0.25
152 0.3
153 0.36
154 0.44
155 0.51
156 0.55
157 0.61
158 0.65
159 0.63
160 0.63
161 0.66
162 0.67
163 0.7
164 0.74
165 0.7
166 0.69
167 0.73
168 0.7
169 0.67
170 0.67
171 0.68
172 0.7
173 0.77
174 0.78
175 0.79
176 0.85
177 0.81
178 0.81
179 0.77
180 0.72
181 0.67
182 0.59
183 0.51
184 0.44
185 0.4
186 0.29
187 0.23
188 0.17
189 0.14
190 0.13
191 0.15
192 0.14
193 0.15
194 0.15
195 0.15
196 0.17
197 0.15
198 0.16
199 0.19
200 0.2
201 0.2
202 0.24
203 0.24
204 0.24
205 0.23
206 0.22
207 0.18
208 0.17
209 0.18
210 0.14
211 0.14
212 0.13
213 0.12
214 0.11
215 0.08
216 0.07
217 0.05
218 0.05
219 0.05
220 0.05
221 0.06
222 0.06
223 0.07
224 0.07
225 0.09
226 0.09
227 0.1
228 0.14
229 0.16
230 0.2
231 0.21
232 0.26
233 0.29
234 0.36
235 0.42
236 0.47
237 0.55
238 0.6
239 0.67
240 0.66
241 0.64
242 0.61
243 0.57
244 0.55
245 0.5
246 0.46
247 0.39
248 0.35
249 0.33
250 0.29
251 0.25
252 0.18
253 0.13
254 0.09