Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3CUP5

Protein Details
Accession A0A2H3CUP5   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
5-29RLYSKGRVLGHKRAKRNTRPNTSLLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11.5, mito_nucl 11.333, nucl 10, cyto_nucl 8.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MGSTRLYSKGRVLGHKRAKRNTRPNTSLLQIEGVATKEDAQFYLGKRVAYVYKAKREVKGSKVRVIWGRVTRPHGSSGVVKSKFRSNLPPRAFGASVRVMLYPSTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.72
4 0.76
5 0.81
6 0.82
7 0.86
8 0.86
9 0.85
10 0.81
11 0.76
12 0.71
13 0.63
14 0.54
15 0.44
16 0.34
17 0.24
18 0.2
19 0.17
20 0.13
21 0.11
22 0.09
23 0.09
24 0.09
25 0.09
26 0.08
27 0.09
28 0.1
29 0.11
30 0.18
31 0.18
32 0.18
33 0.17
34 0.19
35 0.18
36 0.19
37 0.26
38 0.23
39 0.29
40 0.36
41 0.37
42 0.39
43 0.44
44 0.46
45 0.47
46 0.53
47 0.49
48 0.48
49 0.48
50 0.49
51 0.47
52 0.45
53 0.43
54 0.38
55 0.4
56 0.38
57 0.43
58 0.42
59 0.39
60 0.38
61 0.33
62 0.29
63 0.29
64 0.3
65 0.34
66 0.35
67 0.34
68 0.34
69 0.4
70 0.42
71 0.41
72 0.46
73 0.45
74 0.52
75 0.56
76 0.59
77 0.54
78 0.55
79 0.53
80 0.43
81 0.41
82 0.34
83 0.31
84 0.27
85 0.25
86 0.2