Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6JZZ8

Protein Details
Accession B6JZZ8    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-27IATVRKCKYLHEHQLKRLCEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5cyto_nucl 12.5, cyto 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004843  Calcineurin-like_PHP_ApaH  
IPR029052  Metallo-depent_PP-like  
IPR047129  PPA2-like  
IPR006186  Ser/Thr-sp_prot-phosphatase  
Gene Ontology GO:0000785  C:chromatin  
GO:0005737  C:cytoplasm  
GO:0000159  C:protein phosphatase type 2A complex  
GO:0046872  F:metal ion binding  
GO:0017018  F:myosin phosphatase activity  
GO:0004722  F:protein serine/threonine phosphatase activity  
GO:0034599  P:cellular response to oxidative stress  
GO:0006281  P:DNA repair  
GO:0071963  P:establishment or maintenance of cell polarity regulating cell shape  
GO:0000082  P:G1/S transition of mitotic cell cycle  
GO:0035556  P:intracellular signal transduction  
GO:2001211  P:negative regulation of isopentenyl diphosphate biosynthetic process, mevalonate pathway  
GO:0032956  P:regulation of actin cytoskeleton organization  
GO:0060237  P:regulation of fungal-type cell wall organization  
GO:0002098  P:tRNA wobble uridine modification  
Pfam View protein in Pfam  
PF00149  Metallophos  
PROSITE View protein in PROSITE  
PS00125  SER_THR_PHOSPHATASE  
CDD cd07415  MPP_PP2A_PP4_PP6  
Amino Acid Sequences MVELDEWIATVRKCKYLHEHQLKRLCERVKEILMEESNIQPVRTPVTVCGDIHGQFYDLLELFRVSGELPTTNYIFMGDFVDRGYFSLETFTLFMLLKARYPDKVTLLRGNHESRQITQVYGFYDECQTKYGNANVWKYCCQVFDFLTLAAIIDNKILCVHGGLSPEVRTLDQIRILARAQEIPHEGSFCDLMWSDPEDIESWTVSPRGAGWLFGSKVTTEFSHINGLSLIARAHQLVQEGYKFHFPEKSLVTVWSAPNYCYRCGNVASVMKVDETLEPDFRIFSAVPDEERSVPPSRKRSEYFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.41
3 0.49
4 0.6
5 0.65
6 0.71
7 0.73
8 0.81
9 0.79
10 0.75
11 0.72
12 0.66
13 0.59
14 0.57
15 0.55
16 0.51
17 0.5
18 0.47
19 0.46
20 0.42
21 0.38
22 0.34
23 0.28
24 0.28
25 0.26
26 0.24
27 0.18
28 0.18
29 0.2
30 0.2
31 0.19
32 0.17
33 0.23
34 0.26
35 0.25
36 0.26
37 0.25
38 0.24
39 0.25
40 0.22
41 0.16
42 0.13
43 0.14
44 0.14
45 0.11
46 0.1
47 0.09
48 0.09
49 0.08
50 0.08
51 0.08
52 0.06
53 0.07
54 0.08
55 0.08
56 0.1
57 0.12
58 0.13
59 0.12
60 0.12
61 0.12
62 0.1
63 0.1
64 0.11
65 0.09
66 0.08
67 0.09
68 0.09
69 0.09
70 0.09
71 0.1
72 0.08
73 0.08
74 0.09
75 0.09
76 0.09
77 0.1
78 0.09
79 0.09
80 0.09
81 0.09
82 0.11
83 0.11
84 0.12
85 0.14
86 0.16
87 0.16
88 0.19
89 0.21
90 0.23
91 0.28
92 0.29
93 0.33
94 0.34
95 0.35
96 0.37
97 0.38
98 0.35
99 0.36
100 0.34
101 0.28
102 0.3
103 0.28
104 0.23
105 0.21
106 0.2
107 0.16
108 0.17
109 0.16
110 0.12
111 0.15
112 0.16
113 0.15
114 0.15
115 0.14
116 0.13
117 0.15
118 0.16
119 0.18
120 0.22
121 0.26
122 0.27
123 0.29
124 0.29
125 0.28
126 0.27
127 0.23
128 0.19
129 0.17
130 0.15
131 0.15
132 0.14
133 0.13
134 0.12
135 0.11
136 0.1
137 0.07
138 0.07
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.05
148 0.06
149 0.08
150 0.08
151 0.09
152 0.09
153 0.1
154 0.1
155 0.09
156 0.09
157 0.1
158 0.11
159 0.12
160 0.12
161 0.12
162 0.14
163 0.14
164 0.14
165 0.13
166 0.14
167 0.12
168 0.14
169 0.15
170 0.15
171 0.15
172 0.15
173 0.14
174 0.12
175 0.12
176 0.1
177 0.09
178 0.07
179 0.07
180 0.07
181 0.1
182 0.09
183 0.09
184 0.1
185 0.09
186 0.1
187 0.1
188 0.09
189 0.08
190 0.08
191 0.08
192 0.08
193 0.07
194 0.07
195 0.11
196 0.1
197 0.11
198 0.11
199 0.16
200 0.16
201 0.17
202 0.17
203 0.13
204 0.13
205 0.15
206 0.13
207 0.12
208 0.13
209 0.14
210 0.19
211 0.19
212 0.18
213 0.17
214 0.17
215 0.14
216 0.14
217 0.12
218 0.07
219 0.08
220 0.08
221 0.09
222 0.09
223 0.1
224 0.1
225 0.13
226 0.14
227 0.15
228 0.17
229 0.21
230 0.21
231 0.21
232 0.24
233 0.23
234 0.27
235 0.28
236 0.3
237 0.26
238 0.27
239 0.28
240 0.28
241 0.28
242 0.28
243 0.26
244 0.23
245 0.3
246 0.31
247 0.3
248 0.29
249 0.3
250 0.28
251 0.29
252 0.3
253 0.3
254 0.31
255 0.31
256 0.29
257 0.28
258 0.24
259 0.22
260 0.21
261 0.16
262 0.16
263 0.17
264 0.17
265 0.17
266 0.18
267 0.18
268 0.16
269 0.18
270 0.14
271 0.13
272 0.17
273 0.18
274 0.2
275 0.23
276 0.26
277 0.26
278 0.28
279 0.31
280 0.32
281 0.38
282 0.45
283 0.51
284 0.54
285 0.6