Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3DV33

Protein Details
Accession A0A2H3DV33    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
88-107EEKPKKRKRGREGGTSARKRBasic
NLS Segment(s)
PositionSequence
90-126KPKKRKRGREGGTSARKRRVSTTGDARKKAPPKGKIA
Subcellular Location(s) mito 15.5, cyto_mito 10, nucl 7, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MCRSDRPAGKKVNFYLVRFSPPAICESWLAPKDISKFQQHEIEAYINESFKVSGNLLTGYKVRPDPSEWEKYKAEQAEAAALEDVIDEEKPKKRKRGREGGTSARKRRVSTTGDARKKAPPKGKIAGQKENIENENDGKADEDVGTSKKGTSPPLAKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.57
3 0.5
4 0.5
5 0.43
6 0.41
7 0.34
8 0.3
9 0.31
10 0.24
11 0.23
12 0.19
13 0.2
14 0.27
15 0.24
16 0.25
17 0.23
18 0.25
19 0.28
20 0.33
21 0.35
22 0.33
23 0.35
24 0.36
25 0.42
26 0.39
27 0.36
28 0.33
29 0.3
30 0.23
31 0.22
32 0.2
33 0.13
34 0.13
35 0.12
36 0.1
37 0.09
38 0.1
39 0.09
40 0.09
41 0.09
42 0.11
43 0.11
44 0.12
45 0.12
46 0.11
47 0.13
48 0.14
49 0.14
50 0.14
51 0.16
52 0.21
53 0.26
54 0.35
55 0.34
56 0.37
57 0.37
58 0.37
59 0.39
60 0.34
61 0.28
62 0.19
63 0.18
64 0.15
65 0.14
66 0.13
67 0.09
68 0.07
69 0.07
70 0.05
71 0.05
72 0.03
73 0.03
74 0.04
75 0.07
76 0.13
77 0.21
78 0.26
79 0.36
80 0.43
81 0.54
82 0.63
83 0.71
84 0.72
85 0.75
86 0.77
87 0.78
88 0.81
89 0.79
90 0.75
91 0.72
92 0.68
93 0.59
94 0.56
95 0.52
96 0.47
97 0.46
98 0.51
99 0.54
100 0.58
101 0.59
102 0.58
103 0.59
104 0.6
105 0.6
106 0.58
107 0.54
108 0.55
109 0.59
110 0.64
111 0.66
112 0.68
113 0.69
114 0.65
115 0.65
116 0.61
117 0.59
118 0.53
119 0.46
120 0.4
121 0.32
122 0.29
123 0.23
124 0.19
125 0.16
126 0.14
127 0.13
128 0.12
129 0.11
130 0.11
131 0.13
132 0.15
133 0.14
134 0.15
135 0.17
136 0.2
137 0.23
138 0.3
139 0.37