Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JZ68

Protein Details
Accession B6JZ68    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MVWPFTAKKKRKQASQKLKKLRHTLSLHydrophilic
NLS Segment(s)
PositionSequence
8-21KKKRKQASQKLKKL
Subcellular Location(s) nucl 23, mito_nucl 14
Family & Domain DBs
Amino Acid Sequences MVWPFTAKKKRKQASQKLKKLRHTLSLTRMDDSSQLLKPLTSDFEPLSLPPLPSVVDDMNQVMDDLFSEMNYDPETDPFSVVLRELRIKEAVPAYTNDCPPSYKENA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.91
3 0.91
4 0.91
5 0.92
6 0.9
7 0.88
8 0.81
9 0.79
10 0.75
11 0.71
12 0.68
13 0.7
14 0.62
15 0.54
16 0.5
17 0.41
18 0.34
19 0.3
20 0.26
21 0.16
22 0.16
23 0.15
24 0.14
25 0.14
26 0.14
27 0.14
28 0.11
29 0.12
30 0.11
31 0.12
32 0.12
33 0.12
34 0.14
35 0.12
36 0.11
37 0.09
38 0.1
39 0.09
40 0.09
41 0.11
42 0.08
43 0.07
44 0.08
45 0.08
46 0.08
47 0.07
48 0.07
49 0.05
50 0.05
51 0.04
52 0.05
53 0.04
54 0.04
55 0.06
56 0.06
57 0.07
58 0.07
59 0.08
60 0.08
61 0.09
62 0.12
63 0.11
64 0.11
65 0.11
66 0.11
67 0.1
68 0.11
69 0.12
70 0.12
71 0.16
72 0.17
73 0.19
74 0.2
75 0.2
76 0.23
77 0.25
78 0.24
79 0.22
80 0.23
81 0.26
82 0.3
83 0.31
84 0.29
85 0.27
86 0.27
87 0.29