Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JXL9

Protein Details
Accession B6JXL9    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
244-277PSTVKKKTLMHASKQKKPKTRRGKITNTHLNILRHydrophilic
NLS Segment(s)
PositionSequence
250-267KTLMHASKQKKPKTRRGK
Subcellular Location(s) nucl 18, mito_nucl 12.333, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040501  TFA2_Winged_2  
IPR016656  TFIIE-bsu  
IPR003166  TFIIE_bsu_DNA-bd  
Gene Ontology GO:0005673  C:transcription factor TFIIE complex  
GO:0097550  C:transcription preinitiation complex  
GO:0000993  F:RNA polymerase II complex binding  
GO:0003697  F:single-stranded DNA binding  
GO:0001097  F:TFIIH-class transcription factor complex binding  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
Pfam View protein in Pfam  
PF18121  TFA2_Winged_2  
PF02186  TFIIE_beta  
PROSITE View protein in PROSITE  
PS51351  TFIIE_BETA_C  
CDD cd07977  TFIIE_beta_winged_helix  
Amino Acid Sequences MSSLSEQLSSFKKKVANQPIYAKPQIERPTAAYVASRSATPTDVSATSSPAPALGKKKRSKTNLVYSQPADSGVGTHYLSQLHYAVEYLKERNEPKTAEEIASYLSTPLTPMLLQLLKKNDRILYDARHETFTFKPLHNIRSSAGLLAYLDSLKVHAGMSVKELKDGWPNVAAELEELEKRGEVLLLRTKKDAVPKMVWRNDRSCDCHVDDEFKSVWHEIPIPPTLDLATELGKYGLKPTAVDPSTVKKKTLMHASKQKKPKTRRGKITNTHLNILRDYSSMKPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.58
3 0.6
4 0.6
5 0.68
6 0.72
7 0.74
8 0.71
9 0.62
10 0.52
11 0.53
12 0.53
13 0.48
14 0.41
15 0.37
16 0.4
17 0.38
18 0.38
19 0.31
20 0.25
21 0.25
22 0.23
23 0.2
24 0.16
25 0.16
26 0.17
27 0.15
28 0.15
29 0.14
30 0.14
31 0.17
32 0.16
33 0.18
34 0.18
35 0.18
36 0.16
37 0.15
38 0.16
39 0.18
40 0.26
41 0.32
42 0.41
43 0.48
44 0.57
45 0.65
46 0.7
47 0.75
48 0.75
49 0.78
50 0.78
51 0.75
52 0.72
53 0.64
54 0.59
55 0.5
56 0.41
57 0.3
58 0.2
59 0.16
60 0.1
61 0.11
62 0.09
63 0.1
64 0.1
65 0.1
66 0.1
67 0.11
68 0.11
69 0.09
70 0.09
71 0.09
72 0.09
73 0.11
74 0.13
75 0.12
76 0.14
77 0.19
78 0.2
79 0.23
80 0.27
81 0.25
82 0.26
83 0.3
84 0.3
85 0.25
86 0.24
87 0.21
88 0.18
89 0.17
90 0.15
91 0.09
92 0.07
93 0.06
94 0.06
95 0.06
96 0.05
97 0.05
98 0.05
99 0.07
100 0.1
101 0.11
102 0.14
103 0.21
104 0.23
105 0.25
106 0.27
107 0.26
108 0.24
109 0.27
110 0.27
111 0.24
112 0.26
113 0.29
114 0.28
115 0.28
116 0.27
117 0.27
118 0.25
119 0.25
120 0.22
121 0.18
122 0.24
123 0.25
124 0.29
125 0.27
126 0.28
127 0.24
128 0.25
129 0.25
130 0.18
131 0.15
132 0.11
133 0.1
134 0.09
135 0.09
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.05
144 0.06
145 0.07
146 0.1
147 0.15
148 0.15
149 0.15
150 0.15
151 0.15
152 0.2
153 0.2
154 0.18
155 0.16
156 0.16
157 0.16
158 0.16
159 0.15
160 0.09
161 0.1
162 0.1
163 0.07
164 0.07
165 0.07
166 0.06
167 0.07
168 0.07
169 0.07
170 0.06
171 0.09
172 0.17
173 0.21
174 0.23
175 0.23
176 0.25
177 0.26
178 0.34
179 0.35
180 0.33
181 0.35
182 0.42
183 0.51
184 0.57
185 0.61
186 0.57
187 0.56
188 0.57
189 0.56
190 0.53
191 0.47
192 0.45
193 0.42
194 0.43
195 0.4
196 0.39
197 0.33
198 0.31
199 0.28
200 0.24
201 0.23
202 0.19
203 0.19
204 0.15
205 0.17
206 0.15
207 0.19
208 0.2
209 0.2
210 0.19
211 0.19
212 0.17
213 0.15
214 0.15
215 0.12
216 0.11
217 0.1
218 0.1
219 0.1
220 0.11
221 0.1
222 0.12
223 0.14
224 0.13
225 0.13
226 0.15
227 0.24
228 0.24
229 0.26
230 0.26
231 0.32
232 0.42
233 0.43
234 0.42
235 0.37
236 0.41
237 0.46
238 0.55
239 0.53
240 0.53
241 0.62
242 0.7
243 0.75
244 0.8
245 0.82
246 0.81
247 0.83
248 0.84
249 0.85
250 0.87
251 0.89
252 0.89
253 0.91
254 0.91
255 0.92
256 0.92
257 0.85
258 0.81
259 0.75
260 0.67
261 0.58
262 0.51
263 0.41
264 0.32
265 0.3