Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3DCK7

Protein Details
Accession A0A2H3DCK7   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-35RPPLVLKLSLRQRRPKKRRRFSSPQVHSIQHydrophilic
NLS Segment(s)
PositionSequence
16-25RQRRPKKRRR
Subcellular Location(s) mito 15, nucl 10, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MPTCTRPPLVLKLSLRQRRPKKRRRFSSPQVHSIQYTGRTRDGLTTRVNQTAGSHHVLHRVFLPPRIDESAMYASLNKNLADQVSPSSTSIKALAIDRINQGIFC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.64
3 0.67
4 0.73
5 0.77
6 0.85
7 0.86
8 0.87
9 0.9
10 0.93
11 0.93
12 0.92
13 0.91
14 0.91
15 0.88
16 0.85
17 0.78
18 0.69
19 0.59
20 0.5
21 0.42
22 0.37
23 0.33
24 0.27
25 0.24
26 0.23
27 0.23
28 0.27
29 0.26
30 0.23
31 0.23
32 0.25
33 0.26
34 0.27
35 0.27
36 0.22
37 0.2
38 0.19
39 0.19
40 0.17
41 0.16
42 0.15
43 0.2
44 0.2
45 0.2
46 0.19
47 0.2
48 0.18
49 0.22
50 0.23
51 0.18
52 0.21
53 0.24
54 0.23
55 0.18
56 0.21
57 0.19
58 0.18
59 0.17
60 0.15
61 0.13
62 0.15
63 0.17
64 0.13
65 0.11
66 0.11
67 0.12
68 0.12
69 0.12
70 0.13
71 0.14
72 0.15
73 0.15
74 0.17
75 0.17
76 0.17
77 0.17
78 0.15
79 0.15
80 0.15
81 0.21
82 0.21
83 0.24
84 0.25
85 0.27