Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3CUN2

Protein Details
Accession A0A2H3CUN2    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
116-139RITGKLAPLPRRRRTQKMEVVPEDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5cyto_nucl 11.5, cyto 10.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019481  TFIIIC_triple_barrel  
Pfam View protein in Pfam  
PF10419  TFIIIC_sub6  
Amino Acid Sequences SLPAMSICSGYHQVNAFGPGDDYEKEEEIFYVTLELGNVEPVLIPSCDSYYLVLAGTVFKGRHEMLFGTELLFSEHEHAVSYMESTQQRICFREVRLEEKGKAKAKADTFSLVLDRITGKLAPLPRRRRTQKMEVVPEDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.2
4 0.17
5 0.17
6 0.15
7 0.16
8 0.15
9 0.15
10 0.15
11 0.15
12 0.15
13 0.15
14 0.14
15 0.13
16 0.13
17 0.1
18 0.08
19 0.07
20 0.07
21 0.07
22 0.07
23 0.05
24 0.06
25 0.05
26 0.05
27 0.05
28 0.05
29 0.06
30 0.06
31 0.06
32 0.06
33 0.07
34 0.08
35 0.08
36 0.08
37 0.08
38 0.08
39 0.07
40 0.07
41 0.06
42 0.06
43 0.06
44 0.07
45 0.07
46 0.06
47 0.09
48 0.09
49 0.09
50 0.1
51 0.1
52 0.1
53 0.11
54 0.11
55 0.09
56 0.09
57 0.09
58 0.08
59 0.08
60 0.07
61 0.08
62 0.08
63 0.07
64 0.08
65 0.08
66 0.08
67 0.07
68 0.08
69 0.06
70 0.09
71 0.1
72 0.11
73 0.13
74 0.16
75 0.18
76 0.2
77 0.22
78 0.23
79 0.24
80 0.31
81 0.32
82 0.34
83 0.38
84 0.41
85 0.41
86 0.43
87 0.49
88 0.45
89 0.46
90 0.42
91 0.42
92 0.41
93 0.41
94 0.38
95 0.33
96 0.28
97 0.27
98 0.26
99 0.2
100 0.16
101 0.14
102 0.13
103 0.11
104 0.12
105 0.1
106 0.1
107 0.14
108 0.21
109 0.29
110 0.39
111 0.48
112 0.55
113 0.65
114 0.73
115 0.79
116 0.81
117 0.82
118 0.82
119 0.83
120 0.85