Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JUS7

Protein Details
Accession B6JUS7    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
123-144IEADKKRRAREREQRQLQREGKBasic
NLS Segment(s)
PositionSequence
94-138RKKTQLKEWEKMRRQKAEDVLARKKILAEIEADKKRRAREREQRQ
Subcellular Location(s) nucl 23, cyto_nucl 13.833, mito_nucl 12.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR029071  Ubiquitin-like_domsf  
IPR001012  UBX_dom  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0036435  F:K48-linked polyubiquitin modification-dependent protein binding  
GO:0032435  P:negative regulation of proteasomal ubiquitin-dependent protein catabolic process  
GO:1903094  P:negative regulation of protein K48-linked deubiquitination  
GO:0031397  P:negative regulation of protein ubiquitination  
Pfam View protein in Pfam  
PF00789  UBX  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
CDD cd01767  UBX  
Amino Acid Sequences MPYKCNDCEKTFSTVELAELHGVRKGHEEFEEIEASEHKPRTAEEIKETLDRLREKVKDKRRLEQEQYRLEQKKNAEIASKSNKETGDAIEAARKKTQLKEWEKMRRQKAEDVLARKKILAEIEADKKRRAREREQRQLQREGKGQAEKVQKTERAENVSGTSPSSNTARAPATSSRLSIRHAGVTVNLNVPVEETLGQVCAKVMEKMNLPHEPSAFYTTFPKAEFPQSRFTESLKDLGLVPSAVLLLKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.22
4 0.2
5 0.17
6 0.16
7 0.16
8 0.17
9 0.16
10 0.16
11 0.21
12 0.21
13 0.21
14 0.21
15 0.23
16 0.22
17 0.26
18 0.27
19 0.21
20 0.2
21 0.19
22 0.2
23 0.24
24 0.23
25 0.19
26 0.18
27 0.19
28 0.26
29 0.31
30 0.32
31 0.31
32 0.35
33 0.37
34 0.38
35 0.39
36 0.33
37 0.33
38 0.31
39 0.29
40 0.32
41 0.35
42 0.41
43 0.5
44 0.57
45 0.62
46 0.64
47 0.71
48 0.73
49 0.76
50 0.78
51 0.78
52 0.76
53 0.74
54 0.74
55 0.73
56 0.68
57 0.6
58 0.56
59 0.48
60 0.47
61 0.41
62 0.39
63 0.35
64 0.31
65 0.38
66 0.42
67 0.43
68 0.37
69 0.37
70 0.35
71 0.32
72 0.32
73 0.26
74 0.2
75 0.17
76 0.16
77 0.18
78 0.2
79 0.2
80 0.21
81 0.21
82 0.19
83 0.22
84 0.29
85 0.34
86 0.39
87 0.46
88 0.54
89 0.63
90 0.69
91 0.74
92 0.74
93 0.71
94 0.67
95 0.65
96 0.6
97 0.58
98 0.55
99 0.54
100 0.52
101 0.48
102 0.45
103 0.39
104 0.35
105 0.28
106 0.23
107 0.16
108 0.13
109 0.14
110 0.22
111 0.26
112 0.28
113 0.28
114 0.31
115 0.35
116 0.4
117 0.43
118 0.45
119 0.51
120 0.6
121 0.69
122 0.77
123 0.8
124 0.77
125 0.81
126 0.74
127 0.68
128 0.61
129 0.53
130 0.47
131 0.41
132 0.37
133 0.35
134 0.39
135 0.35
136 0.35
137 0.37
138 0.36
139 0.37
140 0.41
141 0.38
142 0.36
143 0.35
144 0.32
145 0.3
146 0.28
147 0.25
148 0.21
149 0.18
150 0.12
151 0.13
152 0.13
153 0.12
154 0.1
155 0.13
156 0.13
157 0.13
158 0.17
159 0.18
160 0.21
161 0.21
162 0.22
163 0.23
164 0.23
165 0.25
166 0.25
167 0.24
168 0.22
169 0.21
170 0.2
171 0.19
172 0.21
173 0.2
174 0.17
175 0.17
176 0.14
177 0.14
178 0.14
179 0.12
180 0.1
181 0.08
182 0.08
183 0.07
184 0.09
185 0.09
186 0.08
187 0.08
188 0.09
189 0.09
190 0.12
191 0.14
192 0.16
193 0.2
194 0.24
195 0.3
196 0.32
197 0.34
198 0.34
199 0.32
200 0.31
201 0.3
202 0.32
203 0.27
204 0.23
205 0.25
206 0.25
207 0.27
208 0.25
209 0.26
210 0.23
211 0.33
212 0.38
213 0.37
214 0.44
215 0.46
216 0.5
217 0.49
218 0.47
219 0.45
220 0.39
221 0.4
222 0.31
223 0.28
224 0.24
225 0.24
226 0.24
227 0.16
228 0.14
229 0.11
230 0.1