Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3CYV2

Protein Details
Accession A0A2H3CYV2   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
57-85EYPAESRRGQHKRPTRKQRPPNSGHDVNFHydrophilic
NLS Segment(s)
PositionSequence
65-74GQHKRPTRKQ
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MNLGRRGSTGSSVGPPNKSSNLACFFCRGRKIACGRPMEGSADMTCNQCARRQLTCEYPAESRRGQHKRPTRKQRPPNSGHDVNFAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.31
4 0.32
5 0.33
6 0.3
7 0.3
8 0.33
9 0.33
10 0.31
11 0.31
12 0.31
13 0.33
14 0.35
15 0.3
16 0.25
17 0.31
18 0.36
19 0.4
20 0.45
21 0.43
22 0.42
23 0.42
24 0.41
25 0.35
26 0.29
27 0.23
28 0.16
29 0.14
30 0.14
31 0.12
32 0.12
33 0.11
34 0.11
35 0.12
36 0.16
37 0.18
38 0.2
39 0.23
40 0.26
41 0.31
42 0.34
43 0.34
44 0.32
45 0.33
46 0.32
47 0.33
48 0.32
49 0.3
50 0.36
51 0.43
52 0.45
53 0.51
54 0.59
55 0.66
56 0.75
57 0.83
58 0.84
59 0.87
60 0.92
61 0.93
62 0.94
63 0.9
64 0.88
65 0.86
66 0.82
67 0.73