Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3EH54

Protein Details
Accession A0A2H3EH54   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAKSKNHTNHNQNKKAHRNGIKKPQAGHydrophilic
NLS Segment(s)
PositionSequence
14-41KKAHRNGIKKPQAGRTRSLKGVDAKFRR
Subcellular Location(s) nucl 20, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKKPQAGRTRSLKGVDAKFRRNARFALVGSVRRSVLSRRLIILTSVYSDKPGQNKKLQQRRNMLLSVLEIAAKHMSGGMTRAMDQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.83
4 0.83
5 0.81
6 0.82
7 0.85
8 0.84
9 0.8
10 0.76
11 0.75
12 0.74
13 0.68
14 0.64
15 0.61
16 0.57
17 0.56
18 0.52
19 0.47
20 0.46
21 0.48
22 0.51
23 0.49
24 0.48
25 0.52
26 0.56
27 0.54
28 0.5
29 0.44
30 0.38
31 0.37
32 0.32
33 0.31
34 0.28
35 0.28
36 0.27
37 0.27
38 0.24
39 0.2
40 0.2
41 0.16
42 0.2
43 0.21
44 0.21
45 0.21
46 0.22
47 0.22
48 0.21
49 0.21
50 0.14
51 0.12
52 0.12
53 0.11
54 0.11
55 0.13
56 0.15
57 0.22
58 0.28
59 0.32
60 0.38
61 0.47
62 0.55
63 0.64
64 0.69
65 0.7
66 0.73
67 0.73
68 0.7
69 0.63
70 0.53
71 0.44
72 0.38
73 0.31
74 0.22
75 0.17
76 0.12
77 0.12
78 0.12
79 0.1
80 0.09
81 0.08
82 0.08
83 0.08
84 0.1
85 0.12
86 0.13