Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K416

Protein Details
Accession B6K416    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPSHKSFRTKQKLAKAQRQNRPIPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, mito_nucl 13.5, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR020083  Ribosomal_L39_CS  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
PROSITE View protein in PROSITE  
PS00051  RIBOSOMAL_L39E  
Amino Acid Sequences MPSHKSFRTKQKLAKAQRQNRPIPQWIRLRTGNTINYNMKRRHWRRTKLNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.83
4 0.83
5 0.83
6 0.79
7 0.76
8 0.72
9 0.7
10 0.63
11 0.6
12 0.59
13 0.54
14 0.53
15 0.48
16 0.45
17 0.41
18 0.43
19 0.42
20 0.37
21 0.4
22 0.42
23 0.46
24 0.51
25 0.5
26 0.52
27 0.58
28 0.61
29 0.66
30 0.7
31 0.74