Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3DCG3

Protein Details
Accession A0A2H3DCG3    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
52-91ESDDKHQKSRKMKRVRHCKQPSKAKKDKHTSRKKVDSDKTBasic
NLS Segment(s)
PositionSequence
58-87QKSRKMKRVRHCKQPSKAKKDKHTSRKKVD
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MFTCDRFDADLTAKKSKDWRAKLEELPKMSMLGDKDSEASTNEDLTTTSDSESDDKHQKSRKMKRVRHCKQPSKAKKDKHTSRKKVDSDKTSRKSPEPQDTEEVEELVDKLAKMRNRKGAKQGNAVKHVLFRLQKRQSHAEAVPHHN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.44
3 0.5
4 0.55
5 0.54
6 0.58
7 0.6
8 0.67
9 0.72
10 0.73
11 0.7
12 0.63
13 0.58
14 0.5
15 0.42
16 0.35
17 0.3
18 0.22
19 0.19
20 0.17
21 0.15
22 0.16
23 0.15
24 0.15
25 0.14
26 0.15
27 0.13
28 0.12
29 0.12
30 0.11
31 0.11
32 0.12
33 0.13
34 0.1
35 0.1
36 0.09
37 0.1
38 0.11
39 0.12
40 0.15
41 0.21
42 0.22
43 0.27
44 0.33
45 0.39
46 0.48
47 0.58
48 0.63
49 0.67
50 0.73
51 0.78
52 0.83
53 0.83
54 0.84
55 0.84
56 0.84
57 0.82
58 0.86
59 0.86
60 0.84
61 0.85
62 0.81
63 0.8
64 0.81
65 0.82
66 0.82
67 0.83
68 0.82
69 0.84
70 0.86
71 0.83
72 0.82
73 0.79
74 0.78
75 0.76
76 0.77
77 0.73
78 0.69
79 0.66
80 0.6
81 0.61
82 0.59
83 0.59
84 0.54
85 0.53
86 0.52
87 0.5
88 0.5
89 0.42
90 0.35
91 0.24
92 0.19
93 0.15
94 0.11
95 0.1
96 0.06
97 0.08
98 0.13
99 0.17
100 0.24
101 0.31
102 0.4
103 0.46
104 0.52
105 0.6
106 0.66
107 0.68
108 0.71
109 0.73
110 0.72
111 0.7
112 0.66
113 0.57
114 0.5
115 0.45
116 0.42
117 0.39
118 0.37
119 0.42
120 0.5
121 0.53
122 0.57
123 0.63
124 0.6
125 0.61
126 0.59
127 0.57