Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3D294

Protein Details
Accession A0A2H3D294    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
34-56AGFRKQMKATKRKTNKRLPPIIEHydrophilic
NLS Segment(s)
PositionSequence
42-47ATKRKT
Subcellular Location(s) cyto 26
Family & Domain DBs
Amino Acid Sequences HLLHVDVCIILRATMGMESAKMEKYEKPLALSEAGFRKQMKATKRKTNKRLPPIIEWEVVNADSVVLLRIRHALMCMWQIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.08
6 0.1
7 0.11
8 0.11
9 0.12
10 0.14
11 0.19
12 0.25
13 0.24
14 0.25
15 0.25
16 0.25
17 0.25
18 0.23
19 0.21
20 0.2
21 0.2
22 0.2
23 0.19
24 0.19
25 0.21
26 0.25
27 0.3
28 0.35
29 0.41
30 0.5
31 0.6
32 0.69
33 0.75
34 0.81
35 0.83
36 0.83
37 0.85
38 0.78
39 0.74
40 0.71
41 0.65
42 0.56
43 0.47
44 0.38
45 0.31
46 0.26
47 0.21
48 0.12
49 0.09
50 0.07
51 0.07
52 0.07
53 0.06
54 0.06
55 0.07
56 0.1
57 0.1
58 0.11
59 0.12
60 0.12
61 0.15