Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6JX09

Protein Details
Accession B6JX09   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
89-108MQNLSKEAIKNRKKRKENEAHydrophilic
NLS Segment(s)
PositionSequence
98-104KNRKKRK
Subcellular Location(s) nucl 20, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR029003  CENP-S/Mhf1  
IPR009072  Histone-fold  
Gene Ontology GO:0071821  C:FANCM-MHF complex  
GO:0046982  F:protein heterodimerization activity  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF15630  CENP-S  
Amino Acid Sequences MEEERFKAEIFHVTQQVCNNTAAELSESESKRVVVDELFCVGVTEMVWEQIKVLAKDVEMFAEHAGRKTVQPQDVVLCSRRNEGLHEIMQNLSKEAIKNRKKRKENEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.37
4 0.32
5 0.29
6 0.24
7 0.19
8 0.18
9 0.16
10 0.13
11 0.1
12 0.11
13 0.17
14 0.18
15 0.18
16 0.19
17 0.18
18 0.17
19 0.17
20 0.15
21 0.09
22 0.1
23 0.1
24 0.11
25 0.11
26 0.1
27 0.1
28 0.09
29 0.08
30 0.06
31 0.06
32 0.05
33 0.06
34 0.07
35 0.06
36 0.06
37 0.09
38 0.11
39 0.1
40 0.11
41 0.1
42 0.1
43 0.11
44 0.11
45 0.09
46 0.07
47 0.07
48 0.06
49 0.09
50 0.1
51 0.09
52 0.1
53 0.11
54 0.11
55 0.16
56 0.21
57 0.2
58 0.21
59 0.21
60 0.23
61 0.25
62 0.28
63 0.25
64 0.23
65 0.22
66 0.24
67 0.25
68 0.23
69 0.24
70 0.26
71 0.28
72 0.28
73 0.28
74 0.27
75 0.26
76 0.29
77 0.26
78 0.22
79 0.18
80 0.17
81 0.18
82 0.26
83 0.35
84 0.41
85 0.51
86 0.62
87 0.71
88 0.79