Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6JW39

Protein Details
Accession B6JW39    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
15-40VRSGGQKPKPFRDKQQKNTEKKEQLTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 10.5, mito 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007218  DNA_pol_delta_4  
Gene Ontology GO:0006260  P:DNA replication  
GO:0000731  P:DNA synthesis involved in DNA repair  
Pfam View protein in Pfam  
PF04081  DNA_pol_delta_4  
Amino Acid Sequences MRRRENIQDQFPRVVRSGGQKPKPFRDKQQKNTEKKEQLTLEERVSQLPELQRKVNEEWESSVNHNPPVHAEGMSKVELVLHKFDMTAKYGPYLGMTRLERWHRAERYGLHPPDFIRHILELPEAYEANNVRKSLFYSVASTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.37
3 0.37
4 0.42
5 0.45
6 0.52
7 0.56
8 0.62
9 0.7
10 0.77
11 0.74
12 0.75
13 0.77
14 0.79
15 0.81
16 0.86
17 0.86
18 0.85
19 0.89
20 0.88
21 0.84
22 0.76
23 0.74
24 0.64
25 0.6
26 0.55
27 0.49
28 0.41
29 0.37
30 0.34
31 0.27
32 0.26
33 0.21
34 0.19
35 0.21
36 0.24
37 0.23
38 0.25
39 0.25
40 0.28
41 0.3
42 0.34
43 0.3
44 0.26
45 0.26
46 0.25
47 0.26
48 0.24
49 0.26
50 0.2
51 0.21
52 0.2
53 0.17
54 0.17
55 0.17
56 0.15
57 0.12
58 0.11
59 0.1
60 0.12
61 0.12
62 0.11
63 0.09
64 0.09
65 0.1
66 0.11
67 0.11
68 0.09
69 0.09
70 0.09
71 0.11
72 0.11
73 0.13
74 0.13
75 0.12
76 0.12
77 0.12
78 0.12
79 0.13
80 0.13
81 0.11
82 0.15
83 0.16
84 0.18
85 0.24
86 0.27
87 0.3
88 0.34
89 0.42
90 0.39
91 0.4
92 0.43
93 0.41
94 0.45
95 0.5
96 0.47
97 0.4
98 0.4
99 0.38
100 0.38
101 0.36
102 0.3
103 0.22
104 0.21
105 0.2
106 0.2
107 0.21
108 0.16
109 0.14
110 0.16
111 0.13
112 0.12
113 0.16
114 0.16
115 0.2
116 0.24
117 0.24
118 0.22
119 0.23
120 0.26
121 0.27
122 0.3
123 0.26