Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K3N2

Protein Details
Accession B6K3N2    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
156-183EEFEKFEKKLREQKKQPEKENKEKEKTKBasic
NLS Segment(s)
PositionSequence
163-183KKLREQKKQPEKENKEKEKTK
Subcellular Location(s) cyto_nucl 15.833, cyto 13.5, nucl 11, mito_nucl 7.331, cyto_pero 7.331
Family & Domain DBs
InterPro View protein in InterPro  
IPR034904  FSCA_dom_sf  
IPR001075  NIF_FeS_clus_asmbl_NifU_C  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0005739  C:mitochondrion  
GO:0005506  F:iron ion binding  
GO:0051536  F:iron-sulfur cluster binding  
GO:0016226  P:iron-sulfur cluster assembly  
GO:0106035  P:protein maturation by [4Fe-4S] cluster transfer  
Pfam View protein in Pfam  
PF01106  NifU  
Amino Acid Sequences MFVPDVNILPPEPAVRKKLYHGQQGCRHVLGSFKTGNIQRHHGAPFHGEPVIDGTPFNPSADTQILDSDSETVAMIKELIDSSIRPSIQEDGGDLEYRGFDEQTGTVYLKLRGSCRTCASSEITLKSGIQQMLMHYIPEVKNVEQQIDPEEEVAIEEFEKFEKKLREQKKQPEKENKEKEKTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.32
4 0.37
5 0.46
6 0.49
7 0.55
8 0.58
9 0.62
10 0.67
11 0.72
12 0.69
13 0.6
14 0.53
15 0.43
16 0.4
17 0.33
18 0.29
19 0.23
20 0.21
21 0.25
22 0.3
23 0.36
24 0.35
25 0.37
26 0.34
27 0.37
28 0.39
29 0.35
30 0.31
31 0.3
32 0.28
33 0.25
34 0.23
35 0.19
36 0.17
37 0.2
38 0.19
39 0.14
40 0.12
41 0.1
42 0.13
43 0.13
44 0.13
45 0.09
46 0.09
47 0.12
48 0.13
49 0.13
50 0.1
51 0.11
52 0.11
53 0.11
54 0.11
55 0.09
56 0.07
57 0.07
58 0.07
59 0.06
60 0.05
61 0.05
62 0.05
63 0.04
64 0.04
65 0.04
66 0.05
67 0.05
68 0.05
69 0.07
70 0.11
71 0.11
72 0.1
73 0.11
74 0.13
75 0.13
76 0.13
77 0.11
78 0.1
79 0.1
80 0.1
81 0.09
82 0.08
83 0.07
84 0.07
85 0.07
86 0.05
87 0.04
88 0.05
89 0.05
90 0.06
91 0.08
92 0.08
93 0.09
94 0.1
95 0.12
96 0.13
97 0.15
98 0.15
99 0.2
100 0.23
101 0.25
102 0.28
103 0.29
104 0.28
105 0.29
106 0.31
107 0.3
108 0.3
109 0.28
110 0.26
111 0.24
112 0.23
113 0.22
114 0.23
115 0.18
116 0.15
117 0.14
118 0.14
119 0.18
120 0.18
121 0.16
122 0.12
123 0.16
124 0.15
125 0.18
126 0.2
127 0.16
128 0.21
129 0.22
130 0.24
131 0.2
132 0.21
133 0.2
134 0.21
135 0.2
136 0.16
137 0.15
138 0.12
139 0.12
140 0.12
141 0.09
142 0.06
143 0.06
144 0.06
145 0.08
146 0.1
147 0.1
148 0.16
149 0.23
150 0.31
151 0.41
152 0.51
153 0.6
154 0.68
155 0.79
156 0.84
157 0.87
158 0.9
159 0.91
160 0.91
161 0.91
162 0.92
163 0.92