Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6K0E4

Protein Details
Accession B6K0E4    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
102-122EAPSARKQKPKEKNSSIQLKEHydrophilic
358-383FGSKMGRRKAPSRMTKNKKKAALAELHydrophilic
NLS Segment(s)
PositionSequence
362-378MGRRKAPSRMTKNKKKA
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007307  Ltv1  
Gene Ontology GO:0005829  C:cytosol  
GO:0005634  C:nucleus  
GO:0030688  C:preribosome, small subunit precursor  
GO:0042274  P:ribosomal small subunit biogenesis  
GO:0000056  P:ribosomal small subunit export from nucleus  
Pfam View protein in Pfam  
PF04180  LTV  
Amino Acid Sequences MGKGKKKFVDKNKATTFHLVHRSQRDPLFYQEGTTEHVLVTTDVLKKSARSIRRAELDDEYSSNVRSNEGEAAMYGVYFDDTEYDYMQHLRNIGNEDATWVEAPSARKQKPKEKNSSIQLKEDIVLPEEVNPSATELPMTYQNQQNVPDAIAGFQPDMDPRLREVLEALEEAEREEGDAELASSIGTNLEAEFAELIKEGPVDENEFYAHGEELKPELEEFNEEAVRQTGKQEWEIEFERFKHEQRKNKAANSDDDFDSEEEFDEVPELVSATTAAPATKPPKARKAKTALSAVSMTSSALFRNEGLTLLDDRFDRIEEEYVPLRDESQLVDPEQKDVNELIHDAQFNNVMDDFLTSFGSKMGRRKAPSRMTKNKKKAALAELDNVRRQLRDVKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.74
3 0.66
4 0.64
5 0.65
6 0.6
7 0.58
8 0.61
9 0.61
10 0.6
11 0.6
12 0.57
13 0.5
14 0.52
15 0.51
16 0.43
17 0.4
18 0.35
19 0.32
20 0.3
21 0.29
22 0.23
23 0.16
24 0.16
25 0.15
26 0.13
27 0.14
28 0.15
29 0.17
30 0.17
31 0.19
32 0.2
33 0.2
34 0.28
35 0.35
36 0.36
37 0.39
38 0.45
39 0.52
40 0.58
41 0.61
42 0.57
43 0.54
44 0.51
45 0.46
46 0.41
47 0.36
48 0.29
49 0.26
50 0.25
51 0.2
52 0.17
53 0.16
54 0.17
55 0.16
56 0.16
57 0.15
58 0.12
59 0.13
60 0.12
61 0.11
62 0.08
63 0.06
64 0.05
65 0.05
66 0.05
67 0.05
68 0.06
69 0.08
70 0.08
71 0.09
72 0.1
73 0.13
74 0.14
75 0.14
76 0.15
77 0.15
78 0.17
79 0.2
80 0.2
81 0.19
82 0.17
83 0.18
84 0.16
85 0.16
86 0.14
87 0.09
88 0.09
89 0.11
90 0.14
91 0.21
92 0.3
93 0.33
94 0.39
95 0.46
96 0.56
97 0.64
98 0.71
99 0.74
100 0.73
101 0.78
102 0.81
103 0.84
104 0.77
105 0.7
106 0.62
107 0.52
108 0.44
109 0.38
110 0.3
111 0.21
112 0.19
113 0.15
114 0.15
115 0.15
116 0.14
117 0.12
118 0.11
119 0.11
120 0.11
121 0.1
122 0.08
123 0.07
124 0.09
125 0.14
126 0.16
127 0.17
128 0.2
129 0.22
130 0.25
131 0.26
132 0.27
133 0.22
134 0.2
135 0.18
136 0.15
137 0.13
138 0.11
139 0.1
140 0.08
141 0.07
142 0.07
143 0.06
144 0.08
145 0.08
146 0.09
147 0.09
148 0.13
149 0.13
150 0.12
151 0.12
152 0.11
153 0.11
154 0.11
155 0.11
156 0.08
157 0.08
158 0.08
159 0.07
160 0.06
161 0.05
162 0.05
163 0.04
164 0.04
165 0.04
166 0.04
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.03
173 0.03
174 0.03
175 0.03
176 0.04
177 0.04
178 0.04
179 0.04
180 0.04
181 0.04
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.05
189 0.07
190 0.07
191 0.07
192 0.07
193 0.07
194 0.07
195 0.07
196 0.07
197 0.06
198 0.06
199 0.06
200 0.07
201 0.07
202 0.07
203 0.06
204 0.07
205 0.06
206 0.08
207 0.08
208 0.09
209 0.09
210 0.09
211 0.09
212 0.1
213 0.11
214 0.09
215 0.1
216 0.12
217 0.13
218 0.15
219 0.18
220 0.18
221 0.22
222 0.24
223 0.24
224 0.22
225 0.21
226 0.25
227 0.24
228 0.27
229 0.32
230 0.37
231 0.45
232 0.51
233 0.61
234 0.61
235 0.64
236 0.67
237 0.6
238 0.6
239 0.55
240 0.51
241 0.41
242 0.35
243 0.32
244 0.26
245 0.23
246 0.17
247 0.12
248 0.09
249 0.09
250 0.08
251 0.07
252 0.06
253 0.06
254 0.05
255 0.05
256 0.04
257 0.04
258 0.05
259 0.04
260 0.05
261 0.05
262 0.06
263 0.06
264 0.11
265 0.15
266 0.19
267 0.27
268 0.32
269 0.42
270 0.52
271 0.56
272 0.61
273 0.66
274 0.68
275 0.67
276 0.68
277 0.58
278 0.52
279 0.48
280 0.39
281 0.31
282 0.24
283 0.17
284 0.12
285 0.11
286 0.08
287 0.08
288 0.09
289 0.08
290 0.09
291 0.1
292 0.09
293 0.1
294 0.11
295 0.12
296 0.12
297 0.14
298 0.12
299 0.13
300 0.13
301 0.13
302 0.13
303 0.12
304 0.14
305 0.13
306 0.17
307 0.2
308 0.2
309 0.21
310 0.2
311 0.19
312 0.17
313 0.17
314 0.15
315 0.17
316 0.19
317 0.19
318 0.25
319 0.24
320 0.26
321 0.28
322 0.26
323 0.23
324 0.21
325 0.21
326 0.16
327 0.17
328 0.16
329 0.17
330 0.18
331 0.16
332 0.17
333 0.19
334 0.18
335 0.18
336 0.16
337 0.13
338 0.12
339 0.14
340 0.13
341 0.1
342 0.11
343 0.1
344 0.1
345 0.11
346 0.16
347 0.18
348 0.25
349 0.33
350 0.4
351 0.46
352 0.52
353 0.6
354 0.66
355 0.74
356 0.77
357 0.79
358 0.82
359 0.88
360 0.92
361 0.91
362 0.88
363 0.84
364 0.81
365 0.78
366 0.76
367 0.7
368 0.68
369 0.68
370 0.66
371 0.62
372 0.57
373 0.5
374 0.42
375 0.4