Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3CL13

Protein Details
Accession A0A2H3CL13    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
44-74QEASEKWQRREKKVRRLGRRLPFRMRTPSKKBasic
NLS Segment(s)
PositionSequence
51-74QRREKKVRRLGRRLPFRMRTPSKK
Subcellular Location(s) nucl 13mito 13mito_nucl 13
Family & Domain DBs
Amino Acid Sequences MGPRNRSCIHRASGPIEIKVPKRHDCTGFERNVEKETSTTTGFQEASEKWQRREKKVRRLGRRLPFRMRTPSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.43
3 0.4
4 0.4
5 0.39
6 0.42
7 0.44
8 0.42
9 0.45
10 0.49
11 0.49
12 0.5
13 0.53
14 0.53
15 0.5
16 0.46
17 0.43
18 0.39
19 0.37
20 0.32
21 0.24
22 0.16
23 0.15
24 0.15
25 0.14
26 0.14
27 0.12
28 0.14
29 0.14
30 0.13
31 0.14
32 0.12
33 0.18
34 0.26
35 0.29
36 0.3
37 0.38
38 0.44
39 0.51
40 0.62
41 0.65
42 0.67
43 0.75
44 0.82
45 0.85
46 0.89
47 0.89
48 0.89
49 0.9
50 0.87
51 0.87
52 0.84
53 0.81
54 0.81