Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3E2X4

Protein Details
Accession A0A2H3E2X4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
16-41AYSRIADRSHIRRRRRHPFIPHSAISHydrophilic
NLS Segment(s)
PositionSequence
28-30RRR
Subcellular Location(s) mito_nucl 12.332, nucl 12, mito 12
Family & Domain DBs
Amino Acid Sequences MPIFPRSIPRFARYSAYSRIADRSHIRRRRRHPFIPHSAISTSLGEDGNHLYRDGPSVPGNHIQPYSSSSISTSLPSICTLCSLVSTRVEELCFTDKFVSDDVCRHGTRVQFLTFKGSFRPTEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.42
3 0.43
4 0.41
5 0.39
6 0.42
7 0.37
8 0.38
9 0.4
10 0.43
11 0.48
12 0.55
13 0.62
14 0.67
15 0.76
16 0.81
17 0.83
18 0.83
19 0.83
20 0.84
21 0.86
22 0.83
23 0.74
24 0.66
25 0.57
26 0.49
27 0.4
28 0.3
29 0.2
30 0.14
31 0.13
32 0.1
33 0.11
34 0.11
35 0.11
36 0.11
37 0.11
38 0.1
39 0.1
40 0.11
41 0.11
42 0.11
43 0.1
44 0.11
45 0.13
46 0.16
47 0.16
48 0.16
49 0.16
50 0.14
51 0.13
52 0.14
53 0.16
54 0.13
55 0.12
56 0.11
57 0.13
58 0.13
59 0.13
60 0.11
61 0.09
62 0.09
63 0.1
64 0.1
65 0.08
66 0.08
67 0.09
68 0.08
69 0.09
70 0.11
71 0.12
72 0.14
73 0.15
74 0.16
75 0.16
76 0.17
77 0.15
78 0.16
79 0.18
80 0.16
81 0.17
82 0.17
83 0.16
84 0.17
85 0.18
86 0.18
87 0.15
88 0.19
89 0.21
90 0.25
91 0.25
92 0.25
93 0.28
94 0.28
95 0.32
96 0.33
97 0.33
98 0.31
99 0.32
100 0.39
101 0.36
102 0.34
103 0.33
104 0.34