Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3DSH2

Protein Details
Accession A0A2H3DSH2    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MMHLLPHIRKRSRSRKRPVYGREVESHydrophilic
NLS Segment(s)
PositionSequence
9-17RKRSRSRKR
Subcellular Location(s) nucl 13mito 13mito_nucl 13
Family & Domain DBs
Amino Acid Sequences MMHLLPHIRKRSRSRKRPVYGREVESGMPTCGENMLGLCGKRRTRLRECERTKTITEGDGLWLYQGMVLSVISIRVRQCCDAGAWSLERQVDSWSSSTITGAASPSPSLGQEGIQQPRSDGPNGEATI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.86
3 0.9
4 0.92
5 0.89
6 0.89
7 0.85
8 0.79
9 0.71
10 0.62
11 0.53
12 0.45
13 0.39
14 0.28
15 0.21
16 0.16
17 0.13
18 0.11
19 0.1
20 0.07
21 0.06
22 0.08
23 0.09
24 0.1
25 0.13
26 0.18
27 0.2
28 0.26
29 0.33
30 0.39
31 0.46
32 0.56
33 0.62
34 0.68
35 0.73
36 0.75
37 0.73
38 0.68
39 0.61
40 0.53
41 0.44
42 0.34
43 0.29
44 0.2
45 0.17
46 0.13
47 0.12
48 0.08
49 0.07
50 0.06
51 0.06
52 0.05
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.05
59 0.04
60 0.06
61 0.07
62 0.09
63 0.11
64 0.12
65 0.12
66 0.12
67 0.13
68 0.13
69 0.14
70 0.13
71 0.13
72 0.13
73 0.15
74 0.14
75 0.14
76 0.13
77 0.13
78 0.13
79 0.13
80 0.13
81 0.12
82 0.13
83 0.13
84 0.12
85 0.11
86 0.1
87 0.09
88 0.09
89 0.08
90 0.08
91 0.08
92 0.09
93 0.09
94 0.09
95 0.1
96 0.1
97 0.1
98 0.15
99 0.22
100 0.27
101 0.3
102 0.3
103 0.3
104 0.34
105 0.37
106 0.33
107 0.28
108 0.25