Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3DYL6

Protein Details
Accession A0A2H3DYL6    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
35-58LAKVEHCRRQWNKPKQPKMERAAPHydrophilic
NLS Segment(s)
PositionSequence
47-62KPKQPKMERAAPKLKW
Subcellular Location(s) nucl 12.5, cyto_nucl 10.833, cyto 8, cyto_pero 5.833, pero 2.5
Family & Domain DBs
Amino Acid Sequences MEEWTKADEDRQECNRQKEEEWRKALTEWEAERDLAKVEHCRRQWNKPKQPKMERAAPKLKWGLSRRAPAGTEVEDNAGDDVEVIRLPQELDEEDWETDESGTDSED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.59
3 0.55
4 0.56
5 0.59
6 0.63
7 0.62
8 0.6
9 0.55
10 0.51
11 0.49
12 0.48
13 0.4
14 0.36
15 0.28
16 0.27
17 0.26
18 0.24
19 0.24
20 0.21
21 0.19
22 0.14
23 0.14
24 0.18
25 0.22
26 0.29
27 0.3
28 0.4
29 0.43
30 0.53
31 0.62
32 0.65
33 0.71
34 0.74
35 0.83
36 0.83
37 0.88
38 0.85
39 0.8
40 0.79
41 0.74
42 0.71
43 0.7
44 0.6
45 0.56
46 0.51
47 0.47
48 0.45
49 0.42
50 0.43
51 0.41
52 0.45
53 0.42
54 0.42
55 0.4
56 0.34
57 0.33
58 0.27
59 0.22
60 0.18
61 0.17
62 0.14
63 0.14
64 0.12
65 0.09
66 0.07
67 0.06
68 0.05
69 0.05
70 0.05
71 0.04
72 0.05
73 0.05
74 0.06
75 0.06
76 0.08
77 0.08
78 0.11
79 0.14
80 0.16
81 0.16
82 0.17
83 0.17
84 0.16
85 0.14
86 0.13
87 0.11