Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JZ89

Protein Details
Accession B6JZ89    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
141-163LRSHRSDRDSERHKKDKQTRRERBasic
NLS Segment(s)
PositionSequence
150-163SERHKKDKQTRRER
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MSSFSSTSSTSPSSPASSRSKLDSFVAELISKNAQEKQNEYRIRGAAAYLNKKRTPSRTDKGFLHNILQRVDSHNEYKLKQRRVRILERHKERENAVMDHSDPLRLSRPADVPYKSRRREQLSDSSCPPNHDKWVHKESGLRSHRSDRDSERHKKDKQTRRER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.3
3 0.33
4 0.34
5 0.36
6 0.4
7 0.39
8 0.37
9 0.37
10 0.33
11 0.29
12 0.26
13 0.25
14 0.2
15 0.19
16 0.19
17 0.18
18 0.17
19 0.16
20 0.2
21 0.22
22 0.24
23 0.28
24 0.33
25 0.41
26 0.44
27 0.45
28 0.44
29 0.4
30 0.39
31 0.34
32 0.28
33 0.24
34 0.27
35 0.34
36 0.33
37 0.38
38 0.39
39 0.42
40 0.46
41 0.47
42 0.49
43 0.49
44 0.52
45 0.54
46 0.57
47 0.57
48 0.59
49 0.58
50 0.51
51 0.46
52 0.41
53 0.35
54 0.31
55 0.29
56 0.23
57 0.22
58 0.23
59 0.21
60 0.19
61 0.22
62 0.23
63 0.23
64 0.32
65 0.36
66 0.42
67 0.44
68 0.48
69 0.52
70 0.56
71 0.64
72 0.65
73 0.68
74 0.69
75 0.73
76 0.75
77 0.69
78 0.65
79 0.57
80 0.53
81 0.46
82 0.37
83 0.31
84 0.25
85 0.23
86 0.22
87 0.21
88 0.16
89 0.12
90 0.12
91 0.14
92 0.14
93 0.14
94 0.16
95 0.18
96 0.21
97 0.26
98 0.27
99 0.29
100 0.38
101 0.47
102 0.47
103 0.5
104 0.55
105 0.58
106 0.61
107 0.62
108 0.63
109 0.59
110 0.61
111 0.59
112 0.58
113 0.52
114 0.5
115 0.48
116 0.41
117 0.43
118 0.45
119 0.47
120 0.48
121 0.54
122 0.52
123 0.5
124 0.52
125 0.49
126 0.53
127 0.53
128 0.49
129 0.47
130 0.54
131 0.58
132 0.55
133 0.56
134 0.54
135 0.58
136 0.63
137 0.69
138 0.7
139 0.73
140 0.77
141 0.82
142 0.84
143 0.84