Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6JXK5

Protein Details
Accession B6JXK5    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
79-114LLIDDSPKPKQKKKETRGRGRGRGRARARGRGRRGFBasic
NLS Segment(s)
PositionSequence
86-114KPKQKKKETRGRGRGRGRARARGRGRRGF
Subcellular Location(s) mito 10, cyto_nucl 9, nucl 8, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR027141  LSm4/Sm_D1/D3  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR034102  Sm_D1  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0071013  C:catalytic step 2 spliceosome  
GO:0000243  C:commitment complex  
GO:0034715  C:pICln-Sm protein complex  
GO:0071014  C:post-mRNA release spliceosomal complex  
GO:0071011  C:precatalytic spliceosome  
GO:0034719  C:SMN-Sm protein complex  
GO:0097526  C:spliceosomal tri-snRNP complex  
GO:0005685  C:U1 snRNP  
GO:0005686  C:U2 snRNP  
GO:0005687  C:U4 snRNP  
GO:0005682  C:U5 snRNP  
GO:0003723  F:RNA binding  
GO:0000387  P:spliceosomal snRNP assembly  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01724  Sm_D1  
Amino Acid Sequences MKLVRFLMKLTNETISIELKNGTIVNGTITSVDMQMNTHLKAVKMTVKDREPVPLETLSIRGSNVRYFILPDSLPLDTLLIDDSPKPKQKKKETRGRGRGRGRARARGRGRRGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.21
3 0.18
4 0.17
5 0.15
6 0.12
7 0.13
8 0.12
9 0.11
10 0.09
11 0.09
12 0.09
13 0.09
14 0.09
15 0.08
16 0.08
17 0.09
18 0.09
19 0.09
20 0.07
21 0.07
22 0.1
23 0.12
24 0.12
25 0.13
26 0.13
27 0.13
28 0.14
29 0.16
30 0.17
31 0.19
32 0.21
33 0.25
34 0.26
35 0.28
36 0.28
37 0.31
38 0.29
39 0.26
40 0.26
41 0.21
42 0.19
43 0.17
44 0.18
45 0.14
46 0.11
47 0.1
48 0.09
49 0.1
50 0.1
51 0.11
52 0.1
53 0.1
54 0.11
55 0.11
56 0.13
57 0.11
58 0.11
59 0.12
60 0.12
61 0.12
62 0.1
63 0.1
64 0.07
65 0.08
66 0.07
67 0.05
68 0.06
69 0.07
70 0.1
71 0.16
72 0.24
73 0.3
74 0.37
75 0.47
76 0.58
77 0.68
78 0.76
79 0.81
80 0.84
81 0.89
82 0.93
83 0.93
84 0.92
85 0.9
86 0.89
87 0.86
88 0.86
89 0.81
90 0.81
91 0.78
92 0.78
93 0.79
94 0.8