Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3CV58

Protein Details
Accession A0A2H3CV58   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
132-155VTEHRYTHKGRDRTRQKRGRQDLNBasic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 12.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR027238  RuvB-like  
IPR010339  TIP49_P-loop  
Gene Ontology GO:0005634  C:nucleus  
GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
GO:0008094  F:ATP-dependent activity, acting on DNA  
GO:0004386  F:helicase activity  
GO:0006325  P:chromatin organization  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF06068  TIP49  
Amino Acid Sequences MTRHGRPNSGISPINRAHRSGYSTRYSRNFSPGFTGVHPHIHGLGLGDRLESRANSQGMVRQAKARSAAGMILKMAQEGRIPGRTMLFAGPSSTGKIAITLGMTQPLVPEVPFMIAVSEVFLAVDVKDGGFVTEHRYTHKGRDRTRQKRGRQDLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.45
3 0.43
4 0.4
5 0.39
6 0.43
7 0.41
8 0.42
9 0.41
10 0.43
11 0.48
12 0.5
13 0.52
14 0.48
15 0.51
16 0.46
17 0.39
18 0.42
19 0.37
20 0.35
21 0.3
22 0.31
23 0.24
24 0.27
25 0.26
26 0.2
27 0.19
28 0.16
29 0.15
30 0.13
31 0.13
32 0.11
33 0.1
34 0.1
35 0.09
36 0.1
37 0.11
38 0.1
39 0.1
40 0.14
41 0.14
42 0.14
43 0.15
44 0.18
45 0.23
46 0.25
47 0.23
48 0.23
49 0.23
50 0.25
51 0.26
52 0.23
53 0.17
54 0.15
55 0.17
56 0.12
57 0.12
58 0.1
59 0.09
60 0.09
61 0.08
62 0.08
63 0.06
64 0.06
65 0.06
66 0.08
67 0.09
68 0.1
69 0.1
70 0.11
71 0.1
72 0.11
73 0.1
74 0.1
75 0.08
76 0.08
77 0.09
78 0.09
79 0.1
80 0.09
81 0.09
82 0.08
83 0.08
84 0.08
85 0.07
86 0.07
87 0.07
88 0.07
89 0.07
90 0.08
91 0.07
92 0.07
93 0.07
94 0.07
95 0.06
96 0.06
97 0.05
98 0.06
99 0.06
100 0.06
101 0.06
102 0.06
103 0.06
104 0.06
105 0.06
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.06
112 0.05
113 0.05
114 0.06
115 0.06
116 0.06
117 0.07
118 0.08
119 0.13
120 0.18
121 0.19
122 0.22
123 0.27
124 0.28
125 0.38
126 0.47
127 0.5
128 0.53
129 0.64
130 0.71
131 0.78
132 0.86
133 0.86
134 0.87
135 0.89