Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JV99

Protein Details
Accession B6JV99    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
94-118CGATKRFSDRPAKKRTKQGQVAQAEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.333, nucl 12, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:0005655  C:nucleolar ribonuclease P complex  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MNKQDQHSRMSYLYQASMLLGTQTDELGLARQYASTIRSISQKNVLRVHPHIKRTICKRCDTPFVYGKTCRVSYEISSAKKPELDRVLRTCAVCGATKRFSDRPAKKRTKQGQVAQAELNVEQQHTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.17
4 0.15
5 0.13
6 0.1
7 0.07
8 0.07
9 0.07
10 0.06
11 0.06
12 0.06
13 0.06
14 0.07
15 0.07
16 0.06
17 0.06
18 0.06
19 0.07
20 0.08
21 0.09
22 0.1
23 0.1
24 0.12
25 0.18
26 0.19
27 0.21
28 0.29
29 0.32
30 0.36
31 0.4
32 0.4
33 0.39
34 0.42
35 0.48
36 0.45
37 0.44
38 0.45
39 0.44
40 0.48
41 0.53
42 0.58
43 0.54
44 0.52
45 0.54
46 0.51
47 0.56
48 0.51
49 0.48
50 0.44
51 0.43
52 0.43
53 0.38
54 0.37
55 0.32
56 0.3
57 0.25
58 0.21
59 0.2
60 0.17
61 0.24
62 0.28
63 0.26
64 0.28
65 0.28
66 0.27
67 0.29
68 0.28
69 0.26
70 0.29
71 0.31
72 0.34
73 0.37
74 0.42
75 0.41
76 0.41
77 0.35
78 0.29
79 0.27
80 0.24
81 0.23
82 0.23
83 0.25
84 0.27
85 0.32
86 0.33
87 0.37
88 0.46
89 0.53
90 0.56
91 0.63
92 0.72
93 0.73
94 0.82
95 0.85
96 0.85
97 0.85
98 0.84
99 0.82
100 0.77
101 0.73
102 0.63
103 0.55
104 0.46
105 0.36
106 0.32
107 0.23