Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3D9Q3

Protein Details
Accession A0A2H3D9Q3    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
16-39PEPVPKKATRKAKDKRKINVHVDEBasic
NLS Segment(s)
PositionSequence
20-32PKKATRKAKDKRK
Subcellular Location(s) mito 14, nucl 9, cyto_nucl 7.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MSSSVLSSSPTSLHAPEPVPKKATRKAKDKRKINVHVDEHGKNERTDPNWAYNHQTELSCRRIQTAGNSIGTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.25
4 0.3
5 0.31
6 0.32
7 0.34
8 0.39
9 0.44
10 0.53
11 0.54
12 0.59
13 0.65
14 0.73
15 0.8
16 0.82
17 0.83
18 0.83
19 0.84
20 0.8
21 0.79
22 0.71
23 0.66
24 0.62
25 0.53
26 0.46
27 0.41
28 0.36
29 0.27
30 0.27
31 0.26
32 0.23
33 0.27
34 0.27
35 0.3
36 0.31
37 0.33
38 0.36
39 0.34
40 0.35
41 0.31
42 0.29
43 0.27
44 0.3
45 0.34
46 0.31
47 0.3
48 0.3
49 0.3
50 0.31
51 0.34
52 0.37
53 0.36