Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3E7N1

Protein Details
Accession A0A2H3E7N1    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
21-45VEAQEKKKTPKGRAKKRVLYNRRFVHydrophilic
NLS Segment(s)
PositionSequence
19-37PKVEAQEKKKTPKGRAKKR
Subcellular Location(s) mito 18, cyto 6, nucl 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEAQEKKKTPKGRAKKRVLYNRRFVNVTTLPGGKRRILVWFRQCPAILRLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.42
3 0.47
4 0.46
5 0.47
6 0.53
7 0.53
8 0.57
9 0.57
10 0.58
11 0.61
12 0.62
13 0.66
14 0.66
15 0.67
16 0.67
17 0.71
18 0.73
19 0.74
20 0.79
21 0.81
22 0.82
23 0.85
24 0.87
25 0.86
26 0.83
27 0.8
28 0.76
29 0.69
30 0.62
31 0.53
32 0.49
33 0.41
34 0.36
35 0.31
36 0.26
37 0.24
38 0.28
39 0.3
40 0.24
41 0.24
42 0.23
43 0.29
44 0.31
45 0.39
46 0.45
47 0.5
48 0.51
49 0.54
50 0.54
51 0.48