Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K0B0

Protein Details
Accession B6K0B0    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
134-155KPPTVIQKGLYKKRKTKSSHEIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 6, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039927  MRPL43/MRPL51  
IPR007741  Ribosome/NADH_DH  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0045454  P:cell redox homeostasis  
GO:0000002  P:mitochondrial genome maintenance  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF05047  L51_S25_CI-B8  
Amino Acid Sequences MIKTVRKISKPLNGLGAFLRPCKRIDFYYCNWGGSSEGMKEFLSRKLEVFAKENGDIEFHVIHRPNQHPSIKSYYVNGRNEEFITRKFSASDILEQALQCSESDGLKPRFVKQPVESLNPSVRGVWNPFSEFAKPPTVIQKGLYKKRKTKSSHEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.41
3 0.4
4 0.32
5 0.33
6 0.34
7 0.27
8 0.28
9 0.31
10 0.33
11 0.32
12 0.38
13 0.41
14 0.41
15 0.49
16 0.49
17 0.46
18 0.42
19 0.37
20 0.3
21 0.24
22 0.22
23 0.14
24 0.13
25 0.14
26 0.14
27 0.15
28 0.16
29 0.19
30 0.21
31 0.19
32 0.19
33 0.22
34 0.25
35 0.26
36 0.27
37 0.25
38 0.24
39 0.24
40 0.25
41 0.2
42 0.18
43 0.16
44 0.14
45 0.12
46 0.09
47 0.12
48 0.13
49 0.14
50 0.19
51 0.22
52 0.24
53 0.3
54 0.33
55 0.3
56 0.33
57 0.39
58 0.36
59 0.34
60 0.32
61 0.34
62 0.37
63 0.39
64 0.36
65 0.3
66 0.28
67 0.28
68 0.28
69 0.22
70 0.16
71 0.2
72 0.19
73 0.19
74 0.18
75 0.17
76 0.19
77 0.19
78 0.2
79 0.14
80 0.14
81 0.15
82 0.14
83 0.15
84 0.11
85 0.1
86 0.07
87 0.07
88 0.07
89 0.07
90 0.09
91 0.16
92 0.18
93 0.22
94 0.23
95 0.26
96 0.33
97 0.35
98 0.4
99 0.34
100 0.42
101 0.42
102 0.47
103 0.45
104 0.41
105 0.42
106 0.39
107 0.37
108 0.29
109 0.26
110 0.23
111 0.25
112 0.26
113 0.25
114 0.25
115 0.26
116 0.27
117 0.29
118 0.28
119 0.27
120 0.29
121 0.27
122 0.27
123 0.34
124 0.34
125 0.32
126 0.34
127 0.39
128 0.44
129 0.53
130 0.61
131 0.62
132 0.68
133 0.76
134 0.83
135 0.81