Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3ERQ2

Protein Details
Accession A0A2H3ERQ2    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
66-85YPNYVYQPQKRTPKPREVKRHydrophilic
NLS Segment(s)
PositionSequence
79-85KPREVKR
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences IPRPPNCYIIFRKDVVAKKLIPKGAEHDSRHLSRIIGELWQKLPEEERRYYHQRAAEELENHKILYPNYVYQPQKRTPKPREVKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.47
3 0.45
4 0.4
5 0.43
6 0.48
7 0.47
8 0.4
9 0.35
10 0.36
11 0.4
12 0.44
13 0.39
14 0.38
15 0.41
16 0.41
17 0.42
18 0.37
19 0.29
20 0.22
21 0.21
22 0.16
23 0.14
24 0.15
25 0.15
26 0.15
27 0.16
28 0.15
29 0.14
30 0.16
31 0.19
32 0.22
33 0.23
34 0.26
35 0.31
36 0.37
37 0.4
38 0.41
39 0.39
40 0.35
41 0.35
42 0.37
43 0.35
44 0.32
45 0.32
46 0.32
47 0.29
48 0.28
49 0.26
50 0.23
51 0.18
52 0.2
53 0.21
54 0.2
55 0.23
56 0.31
57 0.35
58 0.39
59 0.46
60 0.5
61 0.58
62 0.64
63 0.7
64 0.71
65 0.78