Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3DIU7

Protein Details
Accession A0A2H3DIU7    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
100-130RPSSSAPRTRLRYRRRPRTHRRQLLNDPDERBasic
NLS Segment(s)
PositionSequence
109-120RLRYRRRPRTHR
Subcellular Location(s) nucl 14, cyto_nucl 12.5, cyto 9, mito 3
Family & Domain DBs
Amino Acid Sequences MPSCAPFIRRRHLHLSLLPPSDLPRTIPLPWRKLARSTVLLSSPRHDPRDERACLRTITATTQEGPARTAFEPGDSTFQRTGQNSSRTMTRMSRHRGCCRPSSSAPRTRLRYRRRPRTHRRQLLNDPDERISNPGRDFLSEFSKDFIYYSSDIHGLFLLDFLSEHLVAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.63
3 0.6
4 0.57
5 0.51
6 0.43
7 0.4
8 0.36
9 0.31
10 0.25
11 0.21
12 0.22
13 0.25
14 0.33
15 0.38
16 0.4
17 0.44
18 0.49
19 0.47
20 0.49
21 0.5
22 0.47
23 0.44
24 0.42
25 0.41
26 0.39
27 0.41
28 0.37
29 0.35
30 0.36
31 0.37
32 0.36
33 0.34
34 0.32
35 0.37
36 0.45
37 0.46
38 0.42
39 0.4
40 0.4
41 0.39
42 0.37
43 0.3
44 0.21
45 0.21
46 0.2
47 0.18
48 0.16
49 0.19
50 0.19
51 0.18
52 0.18
53 0.15
54 0.15
55 0.14
56 0.16
57 0.12
58 0.12
59 0.13
60 0.13
61 0.17
62 0.14
63 0.17
64 0.16
65 0.18
66 0.19
67 0.19
68 0.22
69 0.23
70 0.27
71 0.25
72 0.25
73 0.26
74 0.24
75 0.26
76 0.25
77 0.24
78 0.28
79 0.35
80 0.42
81 0.47
82 0.54
83 0.59
84 0.59
85 0.61
86 0.58
87 0.57
88 0.54
89 0.57
90 0.57
91 0.58
92 0.61
93 0.61
94 0.64
95 0.66
96 0.7
97 0.7
98 0.73
99 0.76
100 0.81
101 0.84
102 0.89
103 0.91
104 0.93
105 0.94
106 0.93
107 0.91
108 0.89
109 0.88
110 0.88
111 0.83
112 0.75
113 0.67
114 0.58
115 0.51
116 0.42
117 0.36
118 0.28
119 0.26
120 0.23
121 0.24
122 0.23
123 0.23
124 0.24
125 0.23
126 0.28
127 0.26
128 0.25
129 0.23
130 0.24
131 0.22
132 0.2
133 0.19
134 0.16
135 0.15
136 0.15
137 0.16
138 0.16
139 0.16
140 0.17
141 0.16
142 0.12
143 0.11
144 0.1
145 0.08
146 0.06
147 0.06
148 0.07
149 0.1