Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JVQ3

Protein Details
Accession B6JVQ3    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
95-126GQANKIEKASRQQRKQRKNRGKKVFGTGKRLAHydrophilic
NLS Segment(s)
PositionSequence
97-130ANKIEKASRQQRKQRKNRGKKVFGTGKRLAKRKQ
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSEAVTIRTRKFMTNRLLQRKQMVVDILHPGKANISKDDLREKLAEMYKASVENVQAFGLRTQFGGGKTTGFALIYDSNEALNKFEPHYRRVRIGQANKIEKASRQQRKQRKNRGKKVFGTGKRLAKRKQSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.62
3 0.66
4 0.71
5 0.68
6 0.68
7 0.64
8 0.57
9 0.51
10 0.43
11 0.33
12 0.29
13 0.34
14 0.29
15 0.27
16 0.25
17 0.22
18 0.22
19 0.25
20 0.24
21 0.18
22 0.23
23 0.23
24 0.26
25 0.34
26 0.32
27 0.3
28 0.29
29 0.28
30 0.29
31 0.29
32 0.28
33 0.21
34 0.22
35 0.2
36 0.2
37 0.19
38 0.14
39 0.12
40 0.11
41 0.11
42 0.1
43 0.09
44 0.09
45 0.09
46 0.09
47 0.08
48 0.07
49 0.07
50 0.09
51 0.08
52 0.1
53 0.09
54 0.09
55 0.09
56 0.09
57 0.09
58 0.07
59 0.06
60 0.07
61 0.08
62 0.08
63 0.09
64 0.08
65 0.08
66 0.09
67 0.1
68 0.09
69 0.09
70 0.1
71 0.11
72 0.16
73 0.18
74 0.22
75 0.3
76 0.32
77 0.35
78 0.37
79 0.44
80 0.49
81 0.54
82 0.57
83 0.59
84 0.61
85 0.58
86 0.58
87 0.5
88 0.43
89 0.46
90 0.48
91 0.49
92 0.53
93 0.62
94 0.7
95 0.8
96 0.89
97 0.9
98 0.91
99 0.93
100 0.94
101 0.94
102 0.93
103 0.89
104 0.89
105 0.88
106 0.84
107 0.81
108 0.79
109 0.77
110 0.76
111 0.78
112 0.74