Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397G3S0

Protein Details
Accession A0A397G3S0    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
455-482RVTEALKKERRLKNGSKQEERQKDERDDBasic
NLS Segment(s)
Subcellular Location(s) mito 18.5, cyto_mito 11.833, cyto_nucl 4.833, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006769  MCU_C  
IPR039055  MCU_fam  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005262  F:calcium channel activity  
GO:0015292  F:uniporter activity  
GO:0051560  P:mitochondrial calcium ion homeostasis  
Pfam View protein in Pfam  
PF04678  MCU  
Amino Acid Sequences MRALVSRTPIAAALRSATLGSQSATIQYNRLNILDKLPQPLPSRSVRIRYTGVFIPSRVTQIGKRSFQSSAKNRDEREPKRTTADPLERLEVRKVRQRHEPEKDESGRDTKSGGKVVKEMTKGKLLTTPSRLFKLLIPLTTINRKDIEQIAILIHPQQPLSHLERLIQSEVPPIEDENGQKRPPAISFIALQLEQDAIRPKRGMYEGTDAEIHRVEGGKDDETVANRVGIFQEVDETFSYLRRPGPGQGDKEQRFIRWSQSTEIGDFIRDAARAKEFIVTIEGAPAGLEQIHVAVPSFDERTYFLRMRLRKISQRIQGLAEIKHECDALAHRGAQRVALGGFGILAFWWYIVYKLTFETDLGWDTMEPVTYLVSLSTLMGGYLWFLYHNREISYRSALDFTINARQKKLYQMKGIDLQVWESLIDEANGIRREIKNIASEYDVDWDERQDEQDDRVTEALKKERRLKNGSKQEERQKDERDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.14
5 0.13
6 0.13
7 0.12
8 0.12
9 0.11
10 0.14
11 0.17
12 0.18
13 0.19
14 0.21
15 0.24
16 0.24
17 0.26
18 0.26
19 0.24
20 0.28
21 0.33
22 0.33
23 0.35
24 0.35
25 0.4
26 0.41
27 0.44
28 0.44
29 0.42
30 0.47
31 0.48
32 0.54
33 0.5
34 0.5
35 0.51
36 0.48
37 0.47
38 0.43
39 0.42
40 0.36
41 0.34
42 0.32
43 0.3
44 0.3
45 0.27
46 0.25
47 0.23
48 0.31
49 0.39
50 0.4
51 0.41
52 0.41
53 0.45
54 0.48
55 0.54
56 0.54
57 0.56
58 0.61
59 0.65
60 0.64
61 0.69
62 0.74
63 0.71
64 0.71
65 0.66
66 0.6
67 0.6
68 0.6
69 0.56
70 0.56
71 0.58
72 0.55
73 0.51
74 0.54
75 0.5
76 0.5
77 0.51
78 0.46
79 0.42
80 0.45
81 0.47
82 0.46
83 0.54
84 0.61
85 0.64
86 0.69
87 0.71
88 0.69
89 0.73
90 0.72
91 0.65
92 0.59
93 0.53
94 0.44
95 0.38
96 0.33
97 0.29
98 0.29
99 0.32
100 0.31
101 0.28
102 0.3
103 0.34
104 0.38
105 0.38
106 0.38
107 0.35
108 0.39
109 0.37
110 0.35
111 0.35
112 0.33
113 0.34
114 0.38
115 0.41
116 0.38
117 0.4
118 0.4
119 0.36
120 0.34
121 0.38
122 0.33
123 0.27
124 0.27
125 0.27
126 0.29
127 0.36
128 0.35
129 0.28
130 0.27
131 0.26
132 0.26
133 0.26
134 0.25
135 0.18
136 0.18
137 0.16
138 0.15
139 0.15
140 0.14
141 0.14
142 0.12
143 0.12
144 0.11
145 0.12
146 0.16
147 0.21
148 0.22
149 0.2
150 0.21
151 0.24
152 0.26
153 0.26
154 0.23
155 0.18
156 0.19
157 0.19
158 0.18
159 0.16
160 0.13
161 0.13
162 0.14
163 0.16
164 0.17
165 0.22
166 0.21
167 0.21
168 0.22
169 0.22
170 0.21
171 0.23
172 0.18
173 0.16
174 0.17
175 0.17
176 0.18
177 0.16
178 0.15
179 0.11
180 0.1
181 0.09
182 0.09
183 0.14
184 0.13
185 0.16
186 0.16
187 0.16
188 0.19
189 0.21
190 0.21
191 0.18
192 0.23
193 0.22
194 0.23
195 0.25
196 0.21
197 0.21
198 0.19
199 0.15
200 0.09
201 0.09
202 0.08
203 0.09
204 0.11
205 0.1
206 0.1
207 0.11
208 0.12
209 0.12
210 0.14
211 0.11
212 0.1
213 0.09
214 0.09
215 0.08
216 0.08
217 0.07
218 0.05
219 0.07
220 0.07
221 0.08
222 0.08
223 0.08
224 0.08
225 0.09
226 0.09
227 0.08
228 0.09
229 0.09
230 0.1
231 0.13
232 0.21
233 0.26
234 0.3
235 0.35
236 0.44
237 0.44
238 0.48
239 0.45
240 0.38
241 0.35
242 0.32
243 0.32
244 0.26
245 0.27
246 0.24
247 0.28
248 0.28
249 0.26
250 0.27
251 0.2
252 0.16
253 0.14
254 0.13
255 0.08
256 0.08
257 0.08
258 0.08
259 0.09
260 0.09
261 0.1
262 0.12
263 0.11
264 0.11
265 0.11
266 0.11
267 0.09
268 0.1
269 0.09
270 0.06
271 0.06
272 0.06
273 0.04
274 0.03
275 0.03
276 0.03
277 0.04
278 0.04
279 0.04
280 0.04
281 0.04
282 0.04
283 0.06
284 0.07
285 0.07
286 0.07
287 0.09
288 0.12
289 0.18
290 0.19
291 0.21
292 0.27
293 0.3
294 0.35
295 0.42
296 0.45
297 0.47
298 0.53
299 0.58
300 0.57
301 0.6
302 0.56
303 0.5
304 0.48
305 0.44
306 0.37
307 0.34
308 0.28
309 0.23
310 0.22
311 0.2
312 0.15
313 0.13
314 0.15
315 0.14
316 0.15
317 0.17
318 0.18
319 0.21
320 0.21
321 0.21
322 0.18
323 0.16
324 0.14
325 0.11
326 0.09
327 0.06
328 0.06
329 0.05
330 0.05
331 0.03
332 0.03
333 0.03
334 0.03
335 0.04
336 0.04
337 0.04
338 0.06
339 0.07
340 0.07
341 0.08
342 0.1
343 0.1
344 0.1
345 0.12
346 0.12
347 0.12
348 0.12
349 0.11
350 0.1
351 0.11
352 0.11
353 0.09
354 0.08
355 0.06
356 0.07
357 0.06
358 0.07
359 0.05
360 0.05
361 0.05
362 0.05
363 0.06
364 0.05
365 0.05
366 0.05
367 0.05
368 0.05
369 0.05
370 0.05
371 0.05
372 0.06
373 0.11
374 0.14
375 0.16
376 0.17
377 0.19
378 0.22
379 0.24
380 0.29
381 0.26
382 0.24
383 0.24
384 0.22
385 0.22
386 0.2
387 0.2
388 0.24
389 0.29
390 0.29
391 0.3
392 0.33
393 0.34
394 0.44
395 0.5
396 0.48
397 0.5
398 0.52
399 0.56
400 0.6
401 0.59
402 0.51
403 0.42
404 0.36
405 0.29
406 0.25
407 0.19
408 0.13
409 0.12
410 0.09
411 0.09
412 0.08
413 0.08
414 0.14
415 0.15
416 0.15
417 0.19
418 0.2
419 0.24
420 0.27
421 0.3
422 0.3
423 0.31
424 0.32
425 0.29
426 0.3
427 0.27
428 0.28
429 0.25
430 0.21
431 0.19
432 0.19
433 0.18
434 0.18
435 0.19
436 0.18
437 0.19
438 0.2
439 0.26
440 0.26
441 0.26
442 0.27
443 0.27
444 0.27
445 0.32
446 0.39
447 0.39
448 0.46
449 0.54
450 0.6
451 0.67
452 0.73
453 0.77
454 0.78
455 0.83
456 0.85
457 0.85
458 0.86
459 0.88
460 0.89
461 0.86
462 0.83
463 0.8